eco:b3349; : No such data.

KEGG   Escherichia coli K-12 W3110: JW3311Help
Entry
JW3311            CDS       T00068                                 

Gene name
slyD
Definition
(GenBank) FKBP-type peptidyl prolyl cis-trans isomerase
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ecj03110]
    JW3311 (slyD)
Enzymes [BR:ecj01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     JW3311 (slyD)
Chaperones and folding catalysts [BR:ecj03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    JW3311 (slyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: BAE77942
UniProt: P0A9K9
Structure
PDB: 

Position
4161919..4162509
Genome map
AA seq 196 aa AA seqDB search
MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLETALEGHEVGDKFDV
AVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAETDQGPVPVEITAVEDDHVVVD
GNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHHHDHDHDGCCGGHGHDHGHEHG
GEGCCGGKGNGGCGCH
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcaaaagacctggtggtcagcctggcctatcaggtacgtacagaagacggt
gtgttggttgatgagtctccggtgagtgcgccgctggactacctgcatggtcacggttcc
ctgatctctggcctggaaacggcgctggaaggtcatgaagttggcgacaaatttgatgtc
gctgttggcgcgaacgacgcttacggtcagtacgacgaaaacctggtgcaacgtgttcct
aaagacgtatttatgggcgttgatgaactgcaggtaggtatgcgtttcctggctgaaacc
gaccagggtccggtaccggttgaaatcactgcggttgaagacgatcacgtcgtggttgat
ggtaaccacatgctggccggtcagaacctgaaattcaacgttgaagttgtggcgattcgc
gaagcgactgaagaagaactggctcatggtcacgttcacggcgcgcacgatcaccaccac
gatcacgaccacgacggttgctgcggcggtcatggccacgatcacggtcatgaacacggt
ggcgaaggctgctgtggcggtaaaggcaacggcggttgcggttgccactaa

DBGET integrated database retrieval system