KEGG   Escherichia coli K-12 MG1655: b3357Help
Entry
b3357             CDS       T00007                                 

Gene name
crp
Definition
(RefSeq) DNA-binding transcriptional dual regulator CRP
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02020  Two-component system
eco02024  Quorum sensing
eco02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b3357 (crp)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b3357 (crp)
   02026 Biofilm formation - Escherichia coli
    b3357 (crp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b3357 (crp)
Transcription factors [BR:eco03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    b3357 (crp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp MarR_2 HTH_23 RepL HTH_36 MarR HTH_24 Sigma70_r4 HTH_7 Rrf2 HTH_11 HTH_38 DUF4868 HhH-GPD RPA_C
Motif
Other DBs
NCBI-GeneID: 947867
NCBI-ProteinID: NP_417816
Pasteur: crp
RegulonDB: ECK120000160
ECOCYC: EG10164
ASAP: ABE-0010970
UniProt: P0ACJ8
Structure
PDB: 

Position
3486120..3486752
Genome map
AA seq 210 aa AA seqDB search
MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQ
MARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCS
RETVGRILKMLEDQNLISAHGKTIVVYGTR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttggcaaaccgcaaacagacccgactctcgaatggttcttgtctcattgccac
attcataagtacccatccaagagcacgcttattcaccagggtgaaaaagcggaaacgctg
tactacatcgttaaaggctctgtggcagtgctgatcaaagacgaagagggtaaagaaatg
atcctctcctatctgaatcagggtgattttattggcgaactgggcctgtttgaagagggc
caggaacgtagcgcatgggtacgtgcgaaaaccgcctgtgaagtggctgaaatttcgtac
aaaaaatttcgccaattgattcaggtaaacccggacattctgatgcgtttgtctgcacag
atggcgcgtcgtctgcaagtcacttcagagaaagtgggcaacctggcgttcctcgacgtg
acgggccgcattgcacagactctgctgaatctggcaaaacaaccagacgctatgactcac
ccggacggtatgcaaatcaaaattacccgtcaggaaattggtcagattgtcggctgttct
cgtgaaaccgtgggacgcattctgaagatgctggaagatcagaacctgatctccgcacac
ggtaaaaccatcgtcgtttacggcactcgttaa

DBGET integrated database retrieval system