KEGG   Escherichia coli K-12 MG1655: b3367
Entry
b3367             CDS       T00007                                 

Symbol
nirC
Name
(RefSeq) nitrite transporter NirC
  KO
K02598  nitrite transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3367 (nirC)
Transporters [BR:eco02000]
 Other transporters
  Pores ion channels [TC:1]
   b3367 (nirC)
SSDB
Motif
Pfam: Form_Nir_trans
Other DBs
NCBI-GeneID: 2847757
NCBI-ProteinID: YP_026212
Pasteur: nirC
RegulonDB: ECK120000647
ECOCYC: EG10654
ASAP: ABE-0011008
UniProt: P0AC26
Position
3497003..3497809
AA seq 268 aa
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtttacagacactattaataagtgtgcggctaacgctgcgcgcattgcacgcctgtcg
gcaaataacccgctcggcttttgggtcagctccgccatggcgggcgcgtatgtgggtctt
gggatcatcctgattttcacgctcggtaatttgctcgatccatccgtacgccctttggtg
atgggcgcgacctttggtatcgccttaacgctggtgattatcgccggttctgaactgttc
accggacacaccatgttcctcacctttggggtaaaagcgggcagcatcagccacgggcaa
atgtgggcaatcctgccgcaaacctggctgggtaacctggtcggttccgtcttcgttgcc
atgctctatagctggggcggcggtagcctgctgccggtagataccagcatcgttcactcc
gtcgcgctggctaaaaccactgcaccggcaatggtactcttcttcaaaggtgcattgtgt
aactggctggtttgcctggcaatctggatggcgctgcgcactgaaggggcggcgaaattt
atcgctatctggtggtgtctgctggcatttatcgcgtccggctacgagcactctatcgct
aacatgacgctgttcgcgctctcctggttcggcaaccacagcgaagcctacacgctggcg
ggtattggtcataacctgctgtgggtgacgctgggtaatactttatcaggtgccgtattc
atgggattgggttattggtatgctacgccgaaagcgaatcgtccggttgcggacaaattt
aatcaaactgaaacggctgccggttaa

DBGET integrated database retrieval system