KEGG   Escherichia coli K-12 MG1655: b3370Help
Entry
b3370             CDS       T00007                                 

Gene name
frlA
Definition
(RefSeq) putative fructoselysine transporter
  KO
K19540  fructoselysine transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3370 (frlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease Melittin
Motif
Other DBs
NCBI-GeneID: 947878
NCBI-ProteinID: NP_417829
Pasteur: yhfM
RegulonDB: ECK120002424
ECOCYC: EG12908
ASAP: ABE-0011019
UniProt: P45539
Position
3499910..3501247
Genome map
AA seq 445 aa AA seqDB search
MGSQELQRKLGFWAVLAIAVGTTVGSGIFVSVGEVAKAAGTPWLTVLAFVIGGLIVIPQM
CVYAELSTAYPENGADYVYLKNAGSRPLAFLSGWASFWANDAPSLSIMALAIVSNLGFLT
PIDPLLGKFIAAGLIIAFMLLHLRSVEGGAAFQTLITIAKIIPFTIVIGLGIFWFKAENF
AAPTTTAIGATGSFMALLAGISATSWSYTGMASICYMTGEIKNPGKTMPRALIGSCLLVL
VLYTLLALVISGLMPFDKLANSETPISDALTWIPALGSTAGIFVAITAMIVILGSLSSCV
MYQPRLEYAMAKDNLFFKCFGHVHPKYNTPDVSIILQGALGIFFIFVSDLTSLLGYFTLV
MCFKNTLTFGSIIWCRKRDDYKPLWRTPAFGLMTTLAIASSLILVASTFVWAPIPGLICA
VIVIATGLPAYAFWAKRSRQLNALS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggaagccaggaactccaacgcaagctcggattttgggccgttcttgcaatcgccgtc
gggacaaccgtcggctccggtatttttgtatctgtgggtgaagtggcaaaagcagcgggc
acgccgtggcttacggtgctcgcgtttgtcattggcgggttaattgtgatcccgcaaatg
tgcgtctatgcggaactatccaccgcttatccggaaaatggcgcagattatgtttatctg
aaaaatgccggaagccgaccgctggctttcctctccggctgggccagcttctgggccaac
gatgcgccgtcattgtcgattatggcgctggcgattgtcagcaatcttggctttttaacg
cctatcgatccgttgctcggtaaatttatcgccgccggattaattatcgcctttatgttg
ctacacctgcgctccgttgaaggcggcgcagcgtttcagacgctaattaccatcgccaaa
attatcccgttcactatcgtcattggccttgggatcttctggtttaaagcggagaatttt
gccgcccctaccaccactgcgattggcgcaacgggcagctttatggcgctgctggcgggg
atctctgccaccagttggtcgtataccggcatggcctctatctgttatatgaccggcgaa
attaaaaaccccggaaaaaccatgccacgagcgctgattggttcctgtctgctggttctg
gtgctctacaccctgctggcgctggtgatttccggcctgatgcccttcgacaaactcgcc
aattctgaaacgccgatttccgacgccctgacctggatccccgcactcggcagcaccgct
gggatctttgttgccatcacggcgatgatcgtcattcttggttcgctttccagctgcgtg
atgtaccagccgcggctggaatacgcgatggcgaaagacaacctgttctttaaatgcttc
ggccatgtgcatccgaaatacaacacgccggatgtctccatcatcctgcaaggggcgctg
gggatcttcttcatcttcgtttccgatctcaccagcctgctgggttatttcaccctggtg
atgtgtttcaaaaataccctcaccttcggctccatcatctggtgtcgtaaacgcgacgat
tacaaaccgctgtggcgtactccggctttcgggctgatgaccaccctcgccattgcgtca
agcctcattctggtcgcctcaacctttgtctgggcaccgattcccggccttatctgcgcc
gtcatcgttattgctactggtctgcctgcttacgccttctgggcgaagcgtagccgccag
ctcaacgctttgtcgtaa

DBGET integrated database retrieval system