KEGG   Escherichia coli K-12 MG1655: b3403Help
Entry
b3403             CDS       T00007                                 

Gene name
pck
Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00020  Citrate cycle (TCA cycle)
eco00620  Pyruvate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01130  Biosynthesis of antibiotics
eco01200  Carbon metabolism
Module
eco_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b3403 (pck)
   00020 Citrate cycle (TCA cycle)
    b3403 (pck)
   00620 Pyruvate metabolism
    b3403 (pck)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     b3403 (pck)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-GeneID: 945667
NCBI-ProteinID: NP_417862
Pasteur: pck
RegulonDB: ECK120000681
ECOCYC: EG10688
ASAP: ABE-0011106
UniProt: P22259
Structure
PDB: 

Position
3532818..3534440
Genome map
AA seq 540 aa AA seqDB search
MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPSLTGYERGVLTNLGAVAVDTG
IFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTRQLSGKRLFV
VDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELAGFKPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEK
GDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEI
YNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIDNIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
AIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatggtttgaccccgcaagaactcgaggcttatggtatcagtgacgta
catgatatcgtttacaacccaagctacgacctgctgtatcaggaagagctcgatccgagc
ctgacaggttatgagcgcggggtgttaactaatctgggtgccgttgccgtcgataccggg
atcttcaccggtcgttcaccaaaagataagtatatcgtccgtgacgataccactcgcgat
actttctggtgggcagacaaaggcaaaggtaagaacgacaacaaacctctctctccggaa
acctggcagcatctgaaaggcctggtgaccaggcagctttccggcaaacgtctgttcgtt
gtcgacgctttctgtggtgcgaacccggatactcgtctttccgtccgtttcatcaccgaa
gtggcctggcaggcgcattttgtcaaaaacatgtttattcgcccgagcgatgaagaactg
gcaggtttcaaaccagactttatcgttatgaacggcgcgaagtgcactaacccgcagtgg
aaagaacagggtctcaactccgaaaacttcgtggcgtttaacctgaccgagcgcatgcag
ctgattggcggcacctggtacggcggcgaaatgaagaaagggatgttctcgatgatgaac
tacctgctgccgctgaaaggtatcgcttctatgcactgctccgccaacgttggtgagaaa
ggcgatgttgcggtgttcttcggcctttccggcaccggtaaaaccaccctttccaccgac
ccgaaacgtcgcctgattggcgatgacgaacacggctgggacgatgacggcgtgtttaac
ttcgaaggcggctgctacgcaaaaactatcaagctgtcgaaagaagcggaacctgaaatc
tacaacgctatccgtcgtgatgcgttgctggaaaacgtcaccgtgcgtgaagatggcact
atcgactttgatgatggttcaaaaaccgagaacacccgcgtttcttatccgatctatcac
atcgataacattgttaagccggtttccaaagcgggccacgcgactaaggttatcttcctg
actgctgatgctttcggcgtgttgccgccggtttctcgcctgactgccgatcaaacccag
tatcacttcctctctggcttcaccgccaaactggccggtactgagcgtggcatcaccgaa
ccgacgccaaccttctccgcttgcttcggcgcggcattcctgtcgctgcacccgactcag
tacgcagaagtgctggtgaaacgtatgcaggcggcgggcgcgcaggcttatctggttaac
actggctggaacggcactggcaaacgtatctcgattaaagatacccgcgccattatcgac
gccatcctcaacggttcgctggataatgcagaaaccttcactctgccgatgtttaacctg
gcgatcccaaccgaactgccgggcgtagacacgaagattctcgatccgcgtaacacctac
gcttctccggaacagtggcaggaaaaagccgaaaccctggcgaaactgtttatcgacaac
ttcgataaatacaccgacacccctgcgggtgccgcgctggtagcggctggtccgaaactg
taa

DBGET integrated database retrieval system