KEGG   Escherichia coli K-12 MG1655: b3408Help
Entry
b3408             CDS       T00007                                 

Gene name
feoA
Definition
(RefSeq) ferrous iron transport protein A
  KO
K04758  ferrous iron transport protein A
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3408 (feoA)
Transporters [BR:eco02000]
 Other transporters
  Others
   b3408 (feoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FeoA
Motif
Other DBs
NCBI-GeneID: 947909
NCBI-ProteinID: NP_417867
Pasteur: feoA
RegulonDB: ECK120002006
ECOCYC: EG12101
ASAP: ABE-0011124
UniProt: P0AEL3
Structure
PDB: 

Position
3540163..3540390
Genome map
AA seq 75 aa AA seqDB search
MQYTPDTAWKITGFSREISPAYRQKLLSLGMLPGSSFNVVRVAPLGDPIHIETRRVSLVL
RKKDLALLEVEAVSC
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacactccagatactgcgtggaaaatcactggcttttcccgtgaaatcagcccg
gcatatcgccaaaaactgctttctcttggcatgttacctggctcctcttttaatgtggtg
cgcgtcgctccactcggcgaccccattcatatcgaaacccgtcgtgtgagcctggtatta
cgcaaaaaagatctggccttattagaagtggaagcggtttcctgttaa

DBGET integrated database retrieval system