KEGG   Escherichia coli K-12 MG1655: b3421
Entry
b3421             CDS       T00007                                 

Gene name
rtcB
Definition
(RefSeq) RNA-splicing ligase
  KO
K14415  tRNA-splicing ligase RtcB (3'-phosphate/5'-hydroxy nucleic acid ligase) [EC:6.5.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eco03016]
    b3421 (rtcB)
Enzymes [BR:eco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.8  3'-phosphate/5'-hydroxy nucleic acid ligase
     b3421 (rtcB)
Transfer RNA biogenesis [BR:eco03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligases
    b3421 (rtcB)
 Prokaryotic type
    b3421 (rtcB)
SSDB
Motif
Pfam: RtcB DUF4514
Other DBs
NCBI-GeneID: 947929
NCBI-ProteinID: NP_417879
Pasteur: rtcB
RegulonDB: ECK120004293
ECOCYC: G7751
ASAP: ABE-0011170
UniProt: P46850
Position
complement(3556853..3558079)
AA seq 408 aa
MNYELLTTENAPVKMWTKGVPVEADARQQLINTAKMPFIFKHIAVMPDVHLGKGSTIGSV
IPTKGAIIPAAVGVDIGCGMNALRTALTAEDLPENLAELRQAIETAVPHGRTTGRCKRDK
GAWENPPVNVDAKWAELEAGYQWLTQKYPRFLNTNNYKHLGTLGTGNHFIEICLDESDQV
WIMLHSGSRGIGNAIGTYFIDLAQKEMQETLETLPSRDLAYFMEGTEYFDDYLKAVAWAQ
LFASLNRDAMMENVVTALQSITQKTVRQPQTLAMEEINCHHNYVQKEQHFGEEIYVTRKG
AVSARAGQYGIIPGSMGAKSFIVRGLGNEESFCSCSHGAGRVMSRTKAKKLFSVEDQIRA
TAHVECRKDAEVIDEIPMAYKDIDAVMAAQSDLVEVIYTLRQVVCVKG
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaattacgaattactgaccactgaaaatgccccggtaaaaatgtggaccaaaggcgtg
ccggtagaggccgatgcgcgtcagcaacttattaatacggcgaagatgccgtttattttc
aaacatattgcggtaatgcctgatgtacacctgggtaaaggttccaccattggtagcgtg
atcccgaccaaaggggcgattattccggcggcggtgggcgtggatattggctgtggaatg
aacgcgctgcgtaccgcgttaacggcggaagacctgcctgaaaacctggcagagctgcgt
caggcgattgaaacggccgtgccgcacgggcgtaccactggccgttgtaaacgtgataaa
ggtgcctgggaaaatccacctgttaacgtcgatgctaaatgggctgagcttgaagccggt
tatcagtggttaacgcaaaaatatccccgtttcctgaataccaataactataaacacctg
ggaacgctgggaaccggtaaccactttattgaaatctgccttgatgagtcggaccaggtg
tggattatgctgcactccggttcacgcggaattggtaacgccatcgggacttactttatc
gatctggcacaaaaagagatgcaggaaacgcttgagacgttgccgtcgcgtgatctggcg
tactttatggaaggtacggaatactttgatgattacctgaaagccgtggcctgggcgcag
ctttttgccagccttaaccgcgatgcgatgatggaaaacgtggtaacggcattgcagagc
attacgcagaaaacggtcagacagccacaaacgctggcgatggaagagatcaactgtcac
cacaactatgtgcaaaaagaacagcactttggtgaagagatctacgtgacgcgtaaaggc
gcggtgtctgcgcgtgctggtcaatatggaattattcccggttcgatgggagcaaaaagc
tttatcgtccgtgggctgggaaatgaagagtcgttctgttcgtgcagccacggtgccggg
cgggtaatgagccgaactaaagcgaaaaaactgttcagcgtggaagatcaaattcgtgcc
accgcgcatgtggaatgccgtaaagatgccgaagtgatcgacgaaatcccgatggcgtat
aaagatattgatgcggtgatggcggcacaaagcgatctggtggaagttatctataccctg
cgtcaggtggtgtgcgtaaaaggataa

DBGET integrated database retrieval system