KEGG   Escherichia coli K-12 MG1655: b3432Help
Entry
b3432             CDS       T00007                                 

Gene name
glgB
Definition
(RefSeq) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00500  Starch and sucrose metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    b3432 (glgB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eco04147]
    b3432 (glgB)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     b3432 (glgB)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   b3432 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 947940
NCBI-ProteinID: NP_417890
Pasteur: glgB
RegulonDB: ECK120000371
ECOCYC: EG10378
ASAP: ABE-0011209
UniProt: P07762
Structure
PDB: 

Position
complement(3571316..3573502)
Genome map
AA seq 728 aa AA seqDB search
MSDRIDRDVINALIAGHFADPFSVLGMHKTTAGLEVRALLPDATDVWVIEPKTGRKLAKL
ECLDSRGFFSGVIPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKYEMIDANGNLRLKSDPYAFEAQMRPETASLICGLPEKVVQTEERKKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPINEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAEFDGTNLYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNLTYRHHKAMHELDFDPYGFEWLVVDDKERSVLIFVRRDKEGNEIIVASNFTPV
PRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSDEIASHGRQHSLSLTLPPLAT
IWLVREAE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcgtatcgatagagacgtgattaacgcgctaattgcaggccattttgcggat
cctttttccgtactgggaatgcataaaaccaccgcgggactggaagtccgtgccctttta
cccgacgctaccgatgtgtgggtgattgaaccgaaaaccgggcgcaaactcgcaaaactg
gagtgtctcgactcacggggattctttagcggcgtcattccgcgacgtaagaattttttc
cgctatcagttggctgttgtctggcatggtcagcaaaacctgattgatgatccttaccgt
tttggtccgctaatccaggaaatggatgcctggctattatctgaaggtactcacctgcgc
ccgtatgaaaccttaggcgcgcatgcagatactatggatggcgtcacaggtacgcgtttc
tctgtctgggctccaaacgcccgtcgggtctcggtggttgggcaattcaactactgggac
ggtcgccgtcacccgatgcgcctgcgtaaagagagcggcatctgggaactgtttatccct
ggggcgcataacggtcagctctataaatacgagatgattgatgccaatggcaacttgcgt
ctgaagtccgacccttatgcctttgaagcgcaaatgcgcccggaaaccgcgtctcttatt
tgcgggctgccggaaaaggttgtacagactgaagagcgcaaaaaagcgaatcagtttgat
gcgccaatctctatttatgaagttcacctgggttcctggcgtcgccacaccgacaacaat
ttctggttgagctaccgcgagctggccgatcaactggtgccttatgctaaatggatgggc
tttacccacctcgaactactgcccattaacgagcatcccttcgatggcagttggggttat
cagccaaccggcctgtatgcgccaacccgccgttttggtactcgcgacgacttccgttat
ttcattgatgccgcacacgcagctggtctgaacgtgattctcgactgggtgccaggccac
ttcccgactgatgactttgcgcttgccgaatttgatggcacgaacttgtatgaacacagc
gatccgcgtgaaggctatcatcaggactggaacacgctgatctacaactatggtcgccgt
gaagtcagtaacttcctcgtcggtaacgcgctttactggattgaacgttttggtattgat
gcgctgcgcgtcgatgcggtggcgtcaatgatttatcgcgactacagccgtaaagagggg
gagtggatcccgaacgaatttggcgggcgcgagaatcttgaagcgattgaattcttgcgt
aataccaaccgtattcttggtgagcaggtttccggtgcggtgacaatggctgaggagtct
accgatttccctggcgtttctcgtccgcaggatatgggcggtctgggcttctggtacaag
tggaacctcggctggatgcatgacaccctggactacatgaagctcgacccggtttatcgt
cagtatcatcacgataaactgaccttcgggattctctacaactacactgaaaacttcgtc
ctgccgttgtcgcatgatgaagtggtccacggtaaaaaatcgattctcgaccgcatgccg
ggcgacgcatggcagaaattcgcgaacctgcgcgcctactatggctggatgtgggcattc
ccgggcaagaaactactgttcatgggtaacgaatttgcccagggccgcgagtggaaccat
gacgccagcctcgactggcatctgttggaaggcggcgataactggcaccacggtgtccag
cgtctggtgcgcgatctgaacctcacctaccgccaccataaagcaatgcatgaactggat
tttgacccgtacggctttgaatggctggtggtggatgacaaagaacgctcggtgctgatc
tttgtgcgtcgcgataaagagggtaacgaaatcatcgttgccagtaactttacgccggta
ccgcgtcatgattatcgcttcggcataaaccagccgggcaaatggcgtgaaatcctcaat
accgattccatgcactatcacggcagtaatgcaggcaatggcggcacggtacacagcgat
gagattgccagccacggtcgtcagcattcactaagcctgacgctaccaccgctggccact
atctggctggttcgggaggcagaatga

DBGET integrated database retrieval system