KEGG   Escherichia coli K-12 MG1655: b3440Help
Entry
b3440             CDS       T00007                                 

Gene name
yhhX
Definition
(RefSeq) putative oxidoreductase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA GFO_IDH_MocA_C NAD_binding_3 Response_reg
Motif
Other DBs
NCBI-GeneID: 947944
NCBI-ProteinID: NP_417897
Pasteur: yhhX
RegulonDB: ECK120004297
ECOCYC: G7757
ASAP: ABE-0011232
UniProt: P46853
Structure
PDB: 

Position
complement(3579768..3580805)
Genome map
AA seq 345 aa AA seqDB search
MVINCAFIGFGKSTTRYHLPYVLNRKDSWHVAHIFRRHAKPEEQAPIYSHIHFTSDLDEV
LNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAQAKELFALAKSKGLTVT
PYQNRRFDSCFLTAKKAIESGKLGEIVEVESHFDYYRPVAETKPGLPQDGAFYGLGVHTM
DQIISLFGRPDHVAYDIRSLRNKANPDDTFEAQLFYGDLKAIVKTSHLVKIDYPKFIVHG
KKGSFIKYGIDQQETSLKANIMPGEPGFAADDSVGVLEYVNDEGVTVREEMKPEMGDYGR
VYDALYQTITHGAPNYVKESEVLTNLEILERGFEQASPSTVTLAK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtcatcaactgcgcctttattggcttcggcaaaagcaccacccgttaccatctgccg
tatgtacttaaccgcaaggatagctggcatgtcgcgcatatttttcgtcgccatgcgaag
ccggaagaacaggctcccatttattcccatatccatttcaccagcgatctcgacgaagta
ctaaacgatcccgatgttaagctggttgttgtctgcacccacgcggacagccatttcgag
tacgcgaaacgcgcgctggaagccgggaaaaatgtgctggtcgaaaaaccgttcactccg
acacttgcgcaggcgaaagagctgtttgcgttggcgaaaagcaaagggctgaccgtcacg
ccgtatcagaatcgtcgctttgactcctgcttcctgacagcgaaaaaagcgattgaaagt
ggcaagttgggagagattgttgaagtggaaagccattttgactattaccgcccggtggca
gaaaccaaacctgggctgccgcaggatggcgcgttttatggccttggtgtgcatacgatg
gaccagattatttctctgttcggtcgcccggatcacgtcgcttatgacatccgcagcctg
cgtaataaagccaatcctgacgacacctttgaagcgcaactgttttatggcgacctgaaa
gccatcgtcaaaaccagccatctggtgaaaatcgattatccgaaatttatcgttcacggt
aagaaaggttcgtttattaaatacggtatcgaccagcaggaaaccagcctgaaggctaat
attatgccgggcgaaccgggattcgcagcggatgattcggtcggtgtgctggagtatgtc
aatgacgagggcgtgacggtcagagaagagatgaagccggagatgggcgattacgggcgc
gtttatgatgcgttgtatcaaaccatcacccacggtgcgccaaattacgtcaaggaatct
gaagttcttaccaatctggaaatccttgaacgcggatttgagcaagcctctccctccaca
gtaactctcgctaagtaa

DBGET integrated database retrieval system