KEGG   Escherichia coli K-12 MG1655: b3441Help
Entry
b3441             CDS       T00007                                 

Gene name
yhhY
Definition
(RefSeq) aminoacyl nucleotide detoxifying acetyltransferase
  KO
K03825  putative acetyltransferase [EC:2.3.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     b3441 (yhhY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_4 Acetyltransf_10 Acetyltransf_3 Acetyltransf_7 Acetyltransf_8 FR47 Acetyltransf_9
Motif
Other DBs
NCBI-GeneID: 947943
NCBI-ProteinID: NP_417898
Pasteur: yhhY
RegulonDB: ECK120004298
ECOCYC: G7758
ASAP: ABE-0011240
UniProt: P46854
Position
3581138..3581626
Genome map
AA seq 162 aa AA seqDB search
MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDG
DVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTV
FVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagatagtaatacgccacgcagaaacacgggattacgaggccatcaggcagatt
cacgcccagccggaggtgtattgcaacacactacaggtgcctcatccttccgatcatatg
tggcaggagcgactcgccgatcgtcccggcatcaagcaactcgtcgcctgtattgatgga
gacgtcgtgggccatctcaccattgacgtgcaacagcgcccacgccgcagtcatgttgcc
gattttggtatctgtgtcgactctcgttggaagaaccgcggcgtcgccagcgccctgatg
cgagagatgattgaaatgtgcgacaactggttgcgggtagatcgcattgaactaaccgtg
tttgtcgataacgccccggcaattaaggtctataaaaaatacggctttgaaattgaaggg
actggtaagaagtacgcattgcgtaatggtgaatatgtcgatgcatattatatggcgcgg
gtgaagtaa

DBGET integrated database retrieval system