KEGG   Escherichia coli K-12 MG1655: b3445Help
Entry
b3445             CDS       T00007                                 

Gene name
insB1
Definition
(RefSeq) IS1 transposase B
  KO
K07480  insertion element IS1 protein InsB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS1 DDE_Tnp_IS240
Motif
Other DBs
NCBI-GeneID: 947949
NCBI-ProteinID: NP_417902
RegulonDB: ECK120004302
ASAP: ABE-0011251
UniProt: P0CF25 P0CF28 P0CF29
Position
3583677..3584180
Genome map
AA seq 167 aa AA seqDB search
MPGNSPHYGRWPQHDFTSLKKLRPQSVTSRIQPGSDVIVCAEMDEQWGYVGAKSRQRWLF
YAYDSLRKTVVAHVFGERTMATLGRLMSLLSPFDVVIWMTDGWPLYESRLKGKLHVISKR
YTQRIERHNLNLRQHLARLGRKSLSFSKSVELHDKVIGHYLNIKHYQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgccgggcaacagcccgcattatgggcgttggcctcaacacgattttacgtcacttaaa
aaactcaggccgcagtcggtaacctcgcgcatacagccgggcagtgacgtcatcgtctgc
gcggaaatggacgaacagtggggctatgtcggggctaaatcgcgccagcgctggctgttt
tacgcgtatgacagtctccggaagacggttgttgcgcacgtattcggtgaacgcactatg
gcgacgctggggcgtcttatgagcctgctgtcaccctttgacgtggtgatatggatgacg
gatggctggccgctgtatgaatcccgcctgaagggaaagctgcacgtaatcagcaagcga
tatacgcagcgaattgagcggcataacctgaatctgaggcagcacctggcacggctggga
cggaagtcgctgtcgttctcaaaatcggtggagctgcatgacaaagtcatcgggcattat
ctgaacataaaacactatcaataa

DBGET integrated database retrieval system