KEGG   Escherichia coli K-12 MG1655: b3451Help
Entry
b3451             CDS       T00007                                 

Gene name
ugpE
Definition
(RefSeq) sn-glycerol 3-phosphate ABC transporter membrane subunit UgpE
  KO
K05815  sn-glycerol 3-phosphate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00198  Putative sn-glycerol-phosphate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3451 (ugpE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3451 (ugpE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter [MD:M00198]
    b3451 (ugpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-GeneID: 947959
NCBI-ProteinID: NP_417908
Pasteur: ugpE
RegulonDB: ECK120001038
ECOCYC: EG11049
ASAP: ABE-0011270
UniProt: P10906 A0A387CWG9
Position
complement(3589182..3590027)
Genome map
AA seq 281 aa AA seqDB search
MIENRPWLTIFSHTMLILGIAVILFPLYVAFVAATLDKQAVYAAPMTLIPGTHLLENIHN
IWVNGVGTNSAPFWRMLLNSFVMAFSITLGKITVSMLSAFAIVWFRFPLRNLFFWMIFIT
LMLPVEVRIFPTVEVIANLQMLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID
GASPMRFFCDIVFPLSKTNLAALFVITFIYGWNQYLWPLLIITDVDLGTTVAGIKGMIAT
GEGTTEWNSVMVAMLLTLIPPVVIVLVMQRAFVRGLVDSEK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaaccgtccgtggctgacgatattcagccataccatgctgatcctcgggatc
gcggtgatcctcttcccgctgtacgtggcgtttgtcgcggcgacgctggataaacaggcc
gtctatgccgcgccgatgacgctcatccccggcacacatctgctggaaaacatccacaac
atctgggtgaacggggtaggcacgaatagcgcgccgttctggcggatgttgcttaacagc
tttgtgatggcgttcagcattacgctcggcaaaattaccgtctcgatgctctcggcattt
gccattgtctggtttcgttttccgctacgtaacctcttcttctggatgatttttatcacc
ctgatgctgccggttgaagtacgtatcttcccgacggtggaagtcatcgccaacctgcag
atgctcgacagctacgccggtttaacgctgccgctgatggcctcggcgaccgctactttc
ctgttccgccagttctttatgacgctgccggatgagctggtggaagccgcgcggatcgac
ggcgcatcgccaatgcgcttcttttgcgacatcgtttttccgctctccaaaactaatctg
gcggcgctgtttgtgatcacctttatctacggctggaatcagtatttgtggccgttgttg
attattaccgatgtggatctcggcaccaccgtggcagggatcaaagggatgatcgctaca
ggcgaaggcaccacggaatggaactcagtgatggtggcgatgttgttaacgcttatccct
ccggtggtgattgttttagtgatgcagcgtgccttcgtgcgcggcctggtcgatagtgag
aaataa

DBGET integrated database retrieval system