KEGG   Escherichia coli K-12 MG1655: b3452
Entry
b3452             CDS       T00007                                 

Symbol
ugpA
Name
(RefSeq) sn-glycerol 3-phosphate ABC transporter membrane subunit UgpA
  KO
K05814  sn-glycerol 3-phosphate transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3452 (ugpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3452 (ugpA)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter
    b3452 (ugpA)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 947957
NCBI-ProteinID: NP_417909
Pasteur: ugpA
RegulonDB: ECK120001035
ECOCYC: EG11046
ASAP: ABE-0011272
UniProt: P10905
Position
complement(3590024..3590911)
AA seq 295 aa
MSSSRPVFRSRWLPYLLVAPQLIITVIFFIWPAGEALWYSLQSVDPFGFSSQFVGLDNFV
TLFHDSYYLDSFWTTIKFSTFVTVSGLLVSLFFAALVEYIVRGSRFYQTLMLLPYAVAPA
VAAVLWIFLFNPGRGLITHFLAEFGYDWNHAQNSGQAMFLVVFASVWKQISYNFLFFYAA
LQSIPRSLIEAAAIDGAGPIRRFFKIALPLIAPVSFFLLVVNLVYAFFDTFPVIDAATSG
GPVQATTTLIYKIYREGFTGLDLASSAAQSVVLMFLVIVLTVVQFRYVESKVRYQ
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcatcatcccgtccggtgttccgctcgcgctggctgccttatctgctggtcgcgccg
cagctcatcatcaccgttatcttttttatctggcctgcgggcgaagcgttgtggtactcg
ctacaaagcgtcgatccgtttggtttctccagccagtttgtcggcctggataacttcgtc
acgctgttccatgacagctactatctcgactccttctggacgacgataaaattcagcacc
tttgtcaccgtcagcggtttgctggtatcgctgttctttgcggcgctggtggagtacatc
gtgcgcggcagccgtttctatcaaaccttaatgttgctgccttacgccgtggctcccgcc
gttgccgccgtattgtggatcttcctgtttaaccccggtcgcgggctgatcacccatttt
ctcgcggagttcggctacgactggaaccacgcgcaaaacagcggtcaggcaatgtttctg
gtggtgtttgcctcagtatggaagcaaatcagctacaacttcctgttcttctatgccgcg
ctgcaatccattccccgttcgttgatcgaagccgcagccatcgacggtgcagggccgatt
cgccgcttctttaagattgcgctgccgcttatcgccccggtgagtttcttcctgctggta
gtgaacctggtgtatgccttcttcgacaccttcccggtgatcgacgccgccacgtccggc
gggccggttcaggccaccacgacgctgatttataagatctaccgcgaaggttttaccgga
ctggatctggcttcgtctgccgcacagtcggtggtgttgatgttcctcgtcatcgtgctg
acggtggtgcagttccgctatgttgaaagcaaggtgcgttaccaatga

DBGET integrated database retrieval system