KEGG   Escherichia coli K-12 MG1655: b3455
Entry
b3455             CDS       T00007                                 

Gene name
livG
Definition
(RefSeq) branched chain amino acid/phenylalanine ABC transporter ATP binding subunit LivG
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3455 (livG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b3455 (livG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3455 (livG)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    b3455 (livG)
SSDB
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 AAA_23 AAA_15 SMC_N AAA_22 AAA_16 AAA_29 AAA_30 SRP54 FeoB_N AAA_33 MMR_HSR1
Other DBs
NCBI-GeneID: 947967
NCBI-ProteinID: NP_417912
Pasteur: livG
RegulonDB: ECK120000530
ECOCYC: EG10537
ASAP: ABE-0011284
UniProt: P0A9S7
Position
complement(3593439..3594206)
AA seq 255 aa
MSQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGG
TILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKT
PSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEP
AAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQ
IRNNPDVIRAYLGEA
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagtcagccattattatctgttaacggcctgatgatgcgcttcggcggcctgctggcg
gtgaacaacgtcaatcttgaactgtacccgcaggagatcgtctcgttaatcggccctaac
ggtgccggaaaaaccacggtttttaactgtctgaccggattctacaaacccaccggcggc
accattttactgcgcgatcagcacctggaaggtttaccggggcagcaaattgcccgcatg
ggcgtggtgcgcaccttccagcatgtgcgtctgttccgtgaaatgacggtaattgaaaac
ctgctggtggcgcagcatcagcaactgaaaaccgggctgttctctggcctgttgaaaacg
ccatccttccgtcgcgcccagagcgaagcgctcgaccgcgccgcgacctggcttgagcgc
attggtttgctggaacacgccaaccgtcaggcgagtaacctggcctatggtgaccagcgc
cgtcttgagattgcccgctgcatggtgacgcagccggagattttaatgctcgacgaacct
gcggcaggtcttaacccgaaagagacgaaagagctggatgagctgattgccgaactgcgc
aatcatcacaacaccactatcttgttgattgaacacgatatgaagctggtgatgggaatt
tcggaccgaatttacgtggtcaatcaggggacgccgctggcaaacggtacgccggagcag
atccgtaataacccggacgtgatccgtgcctatttaggtgaggcataa

DBGET integrated database retrieval system