KEGG   Escherichia coli K-12 MG1655: b3458
Entry
b3458             CDS       T00007                                 

Symbol
livK
Name
(RefSeq) L-leucine/L-phenylalanine ABC transporter periplasmic binding protein
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3458 (livK)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    b3458 (livK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3458 (livK)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    b3458 (livK)
SSDB
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 PGM_PMM_I Fe-ADH LppC
Other DBs
NCBI-GeneID: 947964
NCBI-ProteinID: NP_417915
Pasteur: livK
RegulonDB: ECK120000533
ECOCYC: EG10540
ASAP: ABE-0011292
UniProt: P04816
Structure
Position
complement(3596451..3597560)
AA seq 369 aa
MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
SPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARS
VQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYV
WITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWH
ADGSSTAAK
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgaaacggaatgcgaaaactatcatcgcagggatgattgcactggcaatttcacacacc
gctatggctgacgatattaaagtcgccgttgtcggcgcgatgtccggcccgattgcccag
tggggcgatatggaatttaacggcgcgcgtcaggcaattaaagacattaatgccaaaggg
ggaattaagggcgataaactggttggcgtggaatatgacgacgcatgcgacccgaaacaa
gccgttgcggtcgccaacaaaatcgttaatgacggcattaaatacgttattggtcatctg
tgttcttcttctacccagcctgcgtcagatatctatgaagacgaaggtattctgatgatc
tcgccgggagcgaccaacccggagctgacccaacgcggttatcaacacattatgcgtact
gccgggctggactcttcccaggggccaacggcggcaaaatacattcttgagacggtgaag
ccccagcgcatcgccatcattcacgacaaacaacagtatggcgaagggctggcgcgttcg
gtgcaggacgggctgaaagcggctaacgccaacgtcgtcttcttcgacggtattaccgcc
ggggagaaagatttctccgcgctgatcgcccgcctgaaaaaagaaaacatcgacttcgtt
tactacggcggttactacccggaaatggggcagatgctgcgccaggcccgttccgttggc
ctgaaaacccagtttatggggccggaaggtgtgggtaatgcgtcgttgtcgaacattgcc
ggtgatgccgccgaaggcatgttggtcactatgccaaaacgctatgaccaggatccggca
aaccagggcatcgttgatgcgctgaaagcagacaagaaagatccgtccgggccttatgtc
tggatcacctacgcggcggtgcaatctctggcgactgcccttgagcgtaccggcagcgat
gagccgctggcgctggtgaaagatttaaaagctaacggtgcaaacaccgtgattgggccg
ctgaactgggatgaaaaaggcgatcttaagggatttgattttggtgtcttccagtggcac
gccgacggttcatccacggcagccaagtga

DBGET integrated database retrieval system