KEGG   Escherichia coli K-12 MG1655: b3466Help
Entry
b3466             CDS       T00007                                 

Gene name
yhhL
Definition
(RefSeq) DUF1145 family protein
  KO
K08993  putative membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1145
Motif
Other DBs
NCBI-GeneID: 947976
NCBI-ProteinID: NP_417923
Pasteur: yhhL
RegulonDB: ECK120002099
ECOCYC: EG12212
ASAP: ABE-0011323
UniProt: P37614
Position
3604979..3605248
Genome map
AA seq 89 aa AA seqDB search
MLINIGRLLMLCVWGFLILNLVHPFPRPLNIFVNVALIFTVLMHGMQLALLKSTLPKDGP
QMTTAEKVRIFLFGVFELLAWQKKFKVKK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaatattggtcgtttgttaatgctctgcgtttggggatttttaatcctcaac
ctggtgcatcccttcccacgcccgctgaatatcttcgttaacgtggcgctgatttttacc
gtgctgatgcatggtatgcagctggcgctattgaaatccactttaccgaaagatggcccg
cagatgaccaccgccgaaaaggtacggattttccttttcggcgtgtttgaactgctggcc
tggcagaagaaatttaaagttaaaaaataa

DBGET integrated database retrieval system