KEGG   Escherichia coli K-12 MG1655: b3472Help
Entry
b3472             CDS       T00007                                 

Gene name
dcrB
Definition
(RefSeq) periplasmic bacteriophage sensitivity protein DcrB
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcrB DUF1454 PRODH
Motif
Other DBs
NCBI-GeneID: 947983
NCBI-ProteinID: NP_417929
Pasteur: dcrB
RegulonDB: ECK120004304
ECOCYC: G7767
ASAP: ABE-0011342
UniProt: P0AEE1
Position
3609955..3610512
Genome map
AA seq 185 aa AA seqDB search
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAENIIN
TLVIQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatctggttaaatatgtcggaattggcctgctggttatggggcttgcggcctgt
gatgataaagacactaacgctacggcgcagggttcggtcgcggaaagtaacgctaccggg
aatcccgtcaacctgcttgatggcaagttaagtttctcgctgccagcggatatgaccgac
cagagcggtaagctgggaacgcaggccaataacatgcatgtctggtccgacgccaccggg
cagaaagcagtcatcgtcatcatgggcgatgatccgaaagaagatctggcggtgctggcg
aagcgtctggaagatcagcaacgtagccgcgatccgcagctgcaagtggtaaccaataaa
gccattgagctgaaaggtcacaaaatgcagcagttagacagtattatctccgcgaaaggc
cagacggcgtactcttccgttattctgggtaacgtgggtaatcaactgctgaccatgcaa
attacgctgcccgctgacgatcagcaaaaagcgcagaccaccgcagaaaacatcattaat
acgctggttattcagtaa

DBGET integrated database retrieval system