KEGG   Escherichia coli K-12 MG1655: b3473
Entry
b3473             CDS       T00007                                 
Symbol
yhhS
Name
(RefSeq) putative transporter YhhS
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: MFS_1 MFS_1_like IF-2B
Other DBs
NCBI-GeneID: 947982
NCBI-ProteinID: NP_417930
Pasteur: yhhS
RegulonDB: ECK120002105
ECOCYC: EG12219
ASAP: ABE-0011344
UniProt: P37621
Position
complement(3610516..3611733)
AA seq 405 aa
MPEPVAEPALNGLRLNLRIVSIVMFNFASYLTIGLPLAVLPGYVHDVMGFSAFWAGLVIS
LQYFATLLSRPHAGRYADSLGPKKIVVFGLCGCFLSGLGYLTAGLTASLPVISLLLLCLG
RVILGIGQSFAGTGSTLWGVGVVGSLHIGRVISWNGIVTYGAMAMGAPLGVVFYHWGGLQ
ALALIIMGVALVAILLAIPRPTVKASKGKPLPFRAVLGRVWLYGMALALASAGFGVIATF
ITLFYDAKGWDGAAFALTLFSCAFVGTRLLFPNGINRIGGLNVAMICFSVEIIGLLLVGV
ATMPWMAKIGVLLAGAGFSLVFPALGVVAVKAVPQQNQGAALATYTVFMDLSLGVTGPLA
GLVMSWAGVPVIYLAAAGLVAIALLLTWRLKKRPPEHVPEAASSS
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcccgaacccgtagccgaacccgcgctaaacggattgcgcctgaatttgcgcattgtc
tctatagtcatgtttaacttcgccagctacctcaccatcgggttgccgctcgctgtatta
ccgggctatgtccatgatgtgatgggctttagcgccttctgggcaggattggttatcagc
ctgcaatatttcgccaccttgctgagccgccctcatgccggacgttacgccgattcgctg
ggacccaaaaagattgtcgtcttcggtttatgcggctgctttttgagcggtctggggtat
ctgacggcaggattaaccgccagtctgcctgtcatcagcctgttattactttgcctgggg
cgcgtcatccttgggattgggcaaagttttgccggaacgggatcgaccctatggggcgtt
ggcgtggttggctcgctgcatatcgggcgggtgatttcgtggaacggcattgtcacttac
ggggcgatggcgatgggtgcgccgttaggcgtcgtgttttatcactggggcggcttgcag
gcgttagcgttaatcattatgggcgtggcgctggtggccattttgttggcgatcccgcgt
ccgacggtaaaagccagtaaaggcaaaccgctgccgtttcgcgcggtgcttgggcgcgtc
tggctgtacggtatggcgctggcactggcttccgccggatttggcgtcatcgccaccttt
atcacgctgttttatgacgctaaaggttgggacggtgcggctttcgcgctgacgctgttt
agctgtgcgtttgtcggtacgcgtttgttattccctaacggcattaaccgtatcggtggc
ttaaacgtagcgatgatttgctttagcgttgagataatcggcctgctactggttggcgtg
gcgactatgccgtggatggcgaaaatcggcgtcttactggcgggggccgggttttcgctg
gtgttcccggcattgggtgtagtggcggtaaaagcggttccgcagcaaaatcagggggcg
gcgctggcaacttacaccgtatttatggatttatcgcttggcgtgactggaccactggct
gggctggtgatgagctgggcgggcgtaccggtgatttatctggcggcggcgggactggtc
gcaatcgcgttattactgacgtggcgattaaaaaaacggcctccggaacacgtccctgag
gccgcctcatcatcttaa

DBGET integrated database retrieval system