KEGG   Escherichia coli K-12 MG1655: b3479Help
Entry
b3479             CDS       T00007                                 

Gene name
nikD
Definition
(RefSeq) Ni(2(+)) ABC transporter ATP binding subunit NikD
  KO
K15587  nickel transport system ATP-binding protein [EC:7.2.2.11]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3479 (nikD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3479 (nikD)
Enzymes [BR:eco01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.11  ABC-type Ni2+ transporter
     b3479 (nikD)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440]
    b3479 (nikD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_22 AAA_19
Motif
Other DBs
NCBI-GeneID: 947989
NCBI-ProteinID: NP_417936
Pasteur: nikD
RegulonDB: ECK120001984
ECOCYC: EG12078
ASAP: ABE-0011360
UniProt: P33593 A0A387CZ31
Position
3617015..3617779
Genome map
AA seq 254 aa AA seqDB search
MPQQIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPAGVRQT
AGEILADGKPVSPCALRGIKIATIMQNPRSAFNPLHTMHTHARETCLALGKPADDATLTA
AIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPTTDLDVVAQARIL
DLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFNAPKHTVTRSL
VSAHLALYGMELAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaacagattgaactacgtaatatcgcgctacaggccgcgcagccgctggtacac
ggtgtatcgttaaccctgcaacgcgggcgcgtgctggcgttagtcggcggtagcggcagc
gggaaatcattaacctgcgccgcaacgctgggcattttgcccgctggcgttcgccagacg
gcgggggaaattttagccgatggcaaaccggtttcgccttgcgccctgcgcggcatcaaa
attgccaccatcatgcagaacccgcgcagcgcctttaatccactgcacaccatgcacacc
cacgcgcgggaaacctgcctggcgttagggaaacccgccgatgacgctacgcttaccgct
gccatagaagcggtggggctggaaaacgccgcgcgcgtgctgaagctgtacccgttcgag
atgagcggcggcatgttgcagcgcatgatgattgcgatggcggtgctgtgtgaatcaccg
tttatcatcgccgatgaaccgaccaccgaccttgacgtggtagcacaggcgcgcatcctc
gatctgctggaaagcattatgcaaaaacaagcgccgggaatgctgctggtgacccatgat
atgggcgttgtggcgcgtctggcggatgacgtggcggtgatgtctgacggtaagattgtc
gaacagggcgatgtagaaacgctgtttaacgcccccaaacatacagtgacgcgcagcctg
gtttccgctcatctcgccctctacggtatggagctggcatcatga

DBGET integrated database retrieval system