KEGG   Escherichia coli K-12 MG1655: b3493Help
Entry
b3493             CDS       T00007                                 

Gene name
pitA
Definition
(RefSeq) metal phosphate:H(+) symporter PitA
  KO
K16322  low-affinity inorganic phosphate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3493 (pitA)
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3493 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-GeneID: 948009
NCBI-ProteinID: NP_417950
Pasteur: pitA
RegulonDB: ECK120002114
ECOCYC: EG12230
ASAP: ABE-0011407
UniProt: P0AFJ7 A0A387CWA4
Position
3637642..3639141
Genome map
AA seq 499 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFLGVLLGGLSVAYAIVHMLPTDLLLNMGSSHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVLSIFGSLIVSPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNATGYEITRTRDAINNVEAYFEQHPALLKQATGADQLVPAPEAGATQ
PAEFHCHPSNTINALNRLKGMLTTDVESYDKLSLDQRSQMRRIMLCVSDTIDKVVKMPGV
SADDQRLLKKLKSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTY
AQGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFT
LPAAVLLSGGLYWLSLQFL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttgtttgctggcctggatttgcataccgggctgttattattgcttgcactg
gcttttgtgctgttctacgaagccatcaatggtttccatgacacagccaacgccgtggca
accgttatctatacccgcgcgatgcgttctcagctcgccgtggttatggcggcggtattc
aactttttgggtgttttgctgggtggtctgagtgttgcctatgccattgtgcatatgctg
ccgacggatctgctgcttaatatgggatcgtctcatggccttgccatggtgttctctatg
ttgctggcggcgattatctggaacctgggtacctggtactttggtttacctgcatccagc
tctcatacgctgattggcgcgatcatcgggattggtttaaccaatgcgttgatgaccggg
acgtcagtggtggatgcactcaatatcccgaaagtattaagtattttcggttctctgatc
gtttcccctattgtcggcctggtgtttgctggcggtctgattttcttgctgcgtcgctac
tggagcggcaccaagaaacgcgcccgtatccacctgaccccagcggagcgtgaaaagaaa
gacggcaagaaaaagccgccgttctggacgcgtattgcgctgatcctttccgctatcggc
gtggcgttttcgcacggcgcgaacgatggtcagaaaggcattggtctggttatgttggta
ttgattggcgtcgcgccagcaggcttcgtggtgaacatgaatgccactggctacgaaatc
acccgtacccgtgatgccatcaacaacgtcgaagcttactttgagcagcatcctgcgctg
ctcaaacaggctaccggtgctgatcagttagtaccggctccggaagctggcgcaacgcaa
cctgcggagttccactgccatccgtcgaataccattaacgcgctcaaccgcctgaaaggt
atgttgaccaccgatgtggaaagctacgacaagctgtcgcttgatcaacgtagccagatg
cgccgcattatgctgtgcgtttctgacactatcgacaaagtggtgaagatgcctggcgtg
agtgctgacgatcagcgcctgttgaagaaactgaagtccgacatgcttagcaccatcgag
tatgcaccggtgtggatcatcatggcggtcgcgctggcgttaggtatcggtacgatgatt
ggctggcgccgtgtggcaacgactatcggtgagaaaatcggtaagaaaggcatgacctac
gctcaggggatgtctgcccagatgacggcggcagtgtctatcggcctggcgagttatacc
gggatgccggtttccactactcacgtactctcctcttctgtcgcggggacgatggtggta
gatggtggcggcttacagcgtaaaaccgtgaccagcattctgatggcctgggtgtttacc
cttccggctgcggtactgctttccggcgggctgtactggctctccttgcagttcctgtaa

DBGET integrated database retrieval system