KEGG   Escherichia coli K-12 MG1655: b3523
Entry
b3523             CDS       T00007                                 

Gene name
yhjE
Definition
(RefSeq) putative transporter YhjE
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 948032
NCBI-ProteinID: NP_417980
Pasteur: yhjE
RegulonDB: ECK120002132
ECOCYC: EG12249
ASAP: ABE-0011509
UniProt: P37643
Position
3674786..3676108
AA seq 440 aa
MQATATTLDHEQEYTPINSRNKVLVASLIGTAIEFFDFYIYATAAVIVFPHIFFPQGDPT
AATLQSLATFAIAFVARPIGSAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPGYATI
GIFAPLLLALARFGQGLGLGGEWGGAALLATENAPPRKRALYGSFPQLGAPIGFFFANGT
FLLLSWLLTDEQFMSWGWRVPFIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLG
TLLTKHVRVTVLGTFIMLATYTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIG
FGVMVPVAGLLADAFGRRKSMVIITTLIILFALFAFNPLLGSGNPILVFAFLLLGLSLMG
LTFGPMGALLPELFPTEVRYTGASFSYNVASILGASVAPYIAAWLQTNYGLGAVGLYLAA
MAGLTLIALLLTHETRHQSL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgcaagcaacagccacaacactcgaccacgagcaagaatacacgccgatcaactcgcgt
aataaagtccttgtcgcctctctcattggcacagccattgagttcttcgacttttacatt
tacgccactgcggccgttattgtgtttccgcatatcttcttcccgcagggcgatcctacg
gcagcaacgctacagtcgctcgccaccttcgccatcgccttcgtcgcgcgccccattggc
tctgccgtttttggtcattttggcgatcgcgttgggcgtaaagcgacgctggtcgcctcg
ttgctaacgatggggatttcgaccgtggtgattggtctgctgccgggctatgccacgatt
ggtattttcgccccgctgctgctggcgctggctcgatttggtcagggtctgggcttaggc
ggtgaatggggcggcgcggcgctgctggcgactgaaaacgccccaccgcgcaaacgtgca
ctgtatggctcctttccgcagctgggcgcaccgattggcttcttctttgccaatggcact
ttcttgctgctttcctggctactgaccgacgagcagtttatgagctggggctggcgtgtg
ccatttatcttctcggcggtgctggtcattatcggcctgtatgttcgcgtgtcgctgcat
gagtcgccggtgtttgagaaagtcgctaaagcgaaaaaacaggtgaagatcccgctgggt
acgctgctgaccaaacatgttcgcgtaaccgtactgggtacgttcattatgctggcaacc
tatacgctgttttacatcatgacggtctactctatgacctttagtaccgccgccgcgcca
gttgggcttggcctgccgcgtaacgaagtgttgtggatgttgatgatggcagttattggt
tttggcgtgatggtgccagtcgctggattactggctgatgcctttggtcgccgtaaaagc
atggtaatcatcaccacgctgatcatcctgttcgcgctgttcgcctttaacccactgctc
ggttctggcaacccgattctggtttttgccttcctgctgctggggttaagtctgatgggt
ctgaccttcgggccaatgggtgcgctgttaccagagctgtttccgacagaagtgcgttac
accggagcatcgttctcttacaacgtagcgtcgattctcggggcttccgttgcgccatat
atcgcagcctggttgcagactaactacgggctaggtgcggtggggttatatctggcggcg
atggctggcttgacgttaatcgccctgctgctgacccatgagacgcgacatcagtcgttg
taa

DBGET integrated database retrieval system