KEGG   Escherichia coli K-12 MG1655: b3524Help
Entry
b3524             CDS       T00007                                 

Gene name
yhjG
Definition
(RefSeq) putative inner membrane-anchored periplasmic AsmA family protein
  KO
K07290  AsmA family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AsmA AsmA_2 DUF748
Motif
Other DBs
NCBI-GeneID: 948043
NCBI-ProteinID: NP_417981
RegulonDB: ECK120002133
ECOCYC: EG12251
ASAP: ABE-0011512
UniProt: P37645
Position
complement(3676290..3678350)
Genome map
AA seq 686 aa AA seqDB search
MSKAGKITAAISGAFLLLIVVAIILIATFDWNRLKPTINQKVSAELNRPFAIRGDLGVVW
ERQKQETGWRSWVPWPHVHAEDIILGNPPDIPEVTMVHLPRVEATLAPLALLTKTVWLPW
IKLEKPDARLIRLSEKNNNWTFNLANDDNKDANAKPSAWSFRLDNILFDQGRIAIDDKVS
KADLEIFVDPLGKPLPFSEVTGSKGKADKEKVGDYVFGLKAQGRYNGEPLTGTGKIGGML
ALRGEGTPFPVQADFRSGNTRVAFDGVVNDPMKMGGVDLRLKFSGDSLGDLYELTGVLLP
DTPPFETDGRLVAKIDTEKSSVFDYRGFNGRIGDSDIHGSLVYTTGKPRPKLEGDVESRQ
LRLADLGPLIGVDSGKGAEKSKRSEQKKGEKSVQPAGKVLPYDRFETDKWDVMDADVRFK
GRRIEHGSSLPISDLSTHIILKNADLRLQPLKFGMAGGSIAANIHLEGDKKPMQGRADIQ
ARRLKLKELMPDVELMQKTLGEMNGDAELRGSGNSVAALLGNSNGNLKLLMNDGLVSRNL
MEIVGLNVGNYIVGAIFGDDEVRVNCAAANLNIANGVARPQIFAFDTENALINVTGTASF
ASEQLDLTIDPESKGIRIITLRSPLYVRGTFKNPQAGVKAGPLIARGAVAAALATLVTPA
AALLALISPSEGEANQCRTILSQMKK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcaggcaaaataaccgctgcgatttcaggggctttcttgttgttgattgtc
gtggcgatcattttgattgcaacttttgactggaatcgactcaaaccgactatcaaccag
aaagtctctgcggagttgaatcgtccgttcgctatccgtggcgatctgggcgtggtgtgg
gagcggcaaaaacaagaaactggctggcgcagctgggtgccgtggccccatgtacacgcg
gaagacatcattcttggcaatccaccggatattcccgaagtcacgatggtgcatttgcca
cgcgtagaggcaacgctggccccgctggcgctgctgaccaaaacggtctggctgccgtgg
atcaagctcgaaaagcccgacgcgcgcctgattcgcctctctgaaaagaacaataactgg
acgtttaatcttgccaacgatgataacaaagacgcgaatgcaaagccgtcggcatggtcg
tttcggctggataatattcttttcgatcaagggcggatcgccattgatgacaaagtaagc
aaagcggatctggagatttttgttgatcccttaggcaagccgctgccgttcagcgaagtt
actggatcgaaaggtaaagcggataaagaaaaggtgggcgattacgtttttggcctgaag
gcgcagggacgatataacggtgaaccgctcacgggtacgggaaaaataggcggtatgctg
gcgctgcgtggcgaagggacgccgtttccggtacaggctgatttccgctctggtaacacc
cgtgttgcttttgatggcgtcgtgaatgacccaatgaagatgggcggtgtcgatttacgg
cttaaattttctggcgattcactgggtgatctctatgaactgacgggcgttctgctgccc
gataccccgccgtttgaaacggatggtcggctggtagcgaaaatcgacactgaaaaatcg
tcggtctttgattatcgcggttttaatgggcgaattggtgatagcgatatccacggttct
ctggtctacaccaccggaaagccacgaccaaaactggaaggtgatgtcgagtcgcggcaa
ttgcggctggcggacctgggaccgttgattggcgttgattccgggaaaggggcagaaaag
tcgaaacggtctgaacagaagaagggcgaaaaaagcgttcagcctgcgggcaaagtgctg
ccttatgaccgcttcgaaaccgataaatgggacgttatggatgccgatgttcgcttcaaa
gggcggcgcattgagcatggcagtagcctgccgattagcgatctttctactcatatcatc
ctcaaaaatgctgacctgcgcctgcaaccgctgaaatttggcatggcgggcggcagcatt
gcggcgaatattcatctggaaggcgataaaaagccgatgcaggggcgggcagatattcag
gctcgtcgactgaaactgaaagaactgatgcccgatgtggaactgatgcagaagacgctg
ggggaaatgaacggtgacgcggaactacgcggtagcggtaactcggtggcggcactttta
ggcaacagtaacggcaacctgaaactgttgatgaatgacgggctggtgagccgcaacctg
atggagattgttgggctgaatgtcggcaactacattgtcggtgcgatatttggtgatgat
gaggtgcgggtgaactgcgcggcggcgaatctgaatattgccaacggcgtggcgcgcccg
cagatttttgctttcgatactgagaacgcgttgattaatgttaccggcacggcaagtttt
gcttcggaacagctggatttgactattgatccggagagtaaaggaattcggattatcaca
ctgcgttcgccgctgtatgtgcgggggacgtttaaaaatccgcaggctggggtgaaagcc
ggaccgctgattgcccgtggtgctgttgctgcggcactggcaacgctggtaacaccggcg
gcggcgttactggcactgatctcaccttccgaaggggaggctaatcagtgtcggacgatt
ttgtcgcagatgaagaagtga

DBGET integrated database retrieval system