KEGG   Escherichia coli K-12 MG1655: b3541Help
Entry
b3541             CDS       T00007                                 

Gene name
dppD
Definition
(RefSeq) dipeptide ABC transporter ATP binding subunit DppD
  KO
K12371  dipeptide transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b3541 (dppD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3541 (dppD)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Dipeptide transporter
    b3541 (dppD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 ABC_ATPase Herpes_ori_bp AAA_29
Motif
Other DBs
NCBI-GeneID: 948065
NCBI-ProteinID: NP_417998
Pasteur: dppD
RegulonDB: ECK120002339
ECOCYC: EG12627
ASAP: ABE-0011566
UniProt: P0AAG0
Position
complement(3702865..3703848)
Genome map
AA seq 327 aa AA seqDB search
MALLNVDKLSVHFGDESAPFRAVDRISYSVKQGEVVGIVGESGSGKSVSSLAIMGLIDYP
GRVMAEKLEFNGQDLQRISEKERRNLVGAEVAMIFQDPMTSLNPCYTVGFQIMEAIKVHQ
GGNKSTRRQRAIDLLNQVGIPDPASRLDVYPHQLSGGMSQRVMIAMAIACRPKLLIADEP
TTALDVTIQAQIIELLLELQQKENMALVLITHDLALVAEAAHKIIVMYAGQVVETGDAHA
IFHAPRHPYTQALLRALPEFAQDKERLASLPGVVPGKYDRPNGCLLNPRCPYATDRCRAE
EPALNMLADGRQSKCHYPLDDAGRPTL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcgttattaaatgtagataaattatcggtgcatttcggcgacgaaagcgcgccgttc
cgcgccgtagaccgcatcagctacagcgtaaaacagggcgaagtggtcgggattgtgggt
gagtccggctccggtaagtcggtcagttcactggcgattatggggctgattgattatccg
ggccgcgtaatggcagaaaaactggagtttaacggccaggatttgcagcgtatctcagaa
aaagagcgccgcaacctggtgggtgccgaagtggcgatgatcttccaggacccgatgacc
agccttaacccgtgctacaccgtgggtttccagattatggaagcgattaaggtgcatcag
ggcggcaacaaaagtacccgccgtcagcgagcgattgacctgctgaatcaggtcggtatt
cccgatccggcatcgcgtctggatgtttacccgcatcagctttccggcggcatgagccag
cgcgtgatgatcgccatggcgattgcctgtcggccaaaactgctgattgccgatgaaccg
accaccgcgctggacgtgaccattcaggcgcaaatcatcgaactactgctggagctacag
cagaaagagaacatggcgctggtgttaattacccatgacctggcgctggtggcggaagcg
gcacataaaatcatcgtgatgtatgcaggccaggtggtggaaaccggtgatgcgcacgcc
atcttccatgcgccgcgtcacccgtatactcaggcattgctgcgtgcgctgccagaattt
gctcaggacaaagaacgtctggcgtcgttgccaggtgtcgttcccggcaagtacgaccgc
ccgaacggctgcctgcttaacccgcgctgcccctatgccactgacagatgtcgcgctgaa
gaaccggcgctgaatatgctcgctgacgggcgtcagtccaaatgccattacccacttgat
gatgccgggaggccgacactatga

DBGET integrated database retrieval system