KEGG   Escherichia coli K-12 MG1655: b3549
Entry
b3549             CDS       T00007                                 

Gene name
tag
Definition
(RefSeq) 3-methyl-adenine DNA glycosylase I, constitutive
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    b3549 (tag)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eco03400]
    b3549 (tag)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     b3549 (tag)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     b3549 (tag)
SSDB
Motif
Pfam: Adenine_glyco YopE_N RBD
Other DBs
NCBI-GeneID: 947137
NCBI-ProteinID: NP_418005
Pasteur: tag
RegulonDB: ECK120000975
ECOCYC: EG10986
ASAP: ABE-0011593
UniProt: P05100
Structure
PDB: 
1P7M 1NKU 1LMZ

Position
3713092..3713655
AA seq 187 aa
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACF
HQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFVDFVWSFV
NHQPQVTQATTLSEIPTSTSASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCC
CYPGNKP
NT seq 564 nt   +upstreamnt  +downstreamnt
atggaacgttgcggctgggtgagtcaggacccgctttatattgcctaccatgataatgag
tggggcgtgcctgaaactgacagtaaaaaactgttcgaaatgatctgccttgaagggcag
caggctggattatcgtggatcaccgtcctcaaaaaacgcgaaaactatcgcgcctgcttt
catcagttcgatccggtgaaggtcgcagcaatgcaggaagaggatgtcgaaagactggta
caggacgccgggattatccgccatcgagggaaaattcaggcaattattggtaatgcgcgg
gcgtacctgcaaatggaacagaacggcgaaccgtttgtcgactttgtctggtcgtttgta
aatcatcagccacaggtgacacaagccacaacgttgagcgaaattcccacatctacgtcc
gcctccgacgccctatctaaggcactgaaaaaacgtggttttaagtttgtcggcaccaca
atctgttactcctttatgcaggcatgtgggctggtgaatgatcatgtggttggctgctgt
tgctatccgggaaataaaccatga

DBGET integrated database retrieval system