KEGG   Escherichia coli K-12 MG1655: b3551
Entry
b3551             CDS       T00007                                 
Symbol
bisC
Name
(RefSeq) biotin sulfoxide reductase
  KO
K08351  biotin/methionine sulfoxide reductase [EC:1.-.-.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00780  Biotin metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    b3551 (bisC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3551 (bisC)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.-  
   1.-.-
    1.-.-.-
     b3551 (bisC)
Transporters [BR:eco02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   b3551 (bisC)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Molybdopterin_N
Other DBs
NCBI-GeneID: 946915
NCBI-ProteinID: NP_418007
RegulonDB: ECK120000120
ECOCYC: EG10124
ASAP: ABE-0011597
UniProt: P20099
Position
complement(3714061..3716394)
AA seq 777 aa
MANSSSRYSVLTAAHWGPMLVETDGETVFSSRGALATGMENSLQSAVRDQVHSNTRVRFP
MVRKGFLASPENPQGIRGQDEFVRVSWDEALDLIHQQHKRIREAYGPASIFAGSYGWRSN
GVLHKASTLLQRYMALAGGYTGHLGDYSTGAAQAIMPYVVGGSEVYQQQTSWPLVLEHSD
VVVLWSANPLNTLKIAWNASDEQGLSYFSALRDSGKKLICIDPMRSETVDFFGDKMEWVA
PHMGTDVALMLGIAHTLVENGWHDEAFLARCTTGYAVFASYLLGESDGIAKTAEWAAEIC
GVGAAKIRELAAIFHQNTTMLMAGWGMQRQQFGEQKHWMIVTLAAMLGQIGTPGGGFGLS
YHFANGGNPTRRSAVLSSMQGSLPGGCDAVDKIPVARIVEALENPGGAYQHNGMNRHFPD
IRFIWWAGGANFTHHQDTNRLIRAWQKPELVVISECFWTAAAKHADIVLPATTSFERNDL
TMTGDYSNQHLVPMKQVVPPRYEARNDFDVFAELSERWEKGGYARFTEGKSELQWLETFY
NVARQRGASQQVELPPFAEFWQANQLIEMPENPDSERFIRFADFCRDPLAHPLKTASGKI
EIFSQRIADYGYPDCPGHPMWLEPDEWQGNAEPEQLQVLSAHPAHRLHSQLNYSSLRELY
AVANREPVTIHPDDAQERGIQDGDTVRLWNARGQILAGAVISEGIKPGVICIHEGAWPDL
DLTADGICKNGAVNVLTKDLPSSRLGNGCAGNTALAWLEKYNGPELTLTAFEPPASS
NT seq 2334 nt   +upstreamnt  +downstreamnt
ttggccaactcatcctcacgatattccgttctgactgccgcccattgggggcccatgctg
gttgaaaccgacggcgaaaccgtgtttagctcgcgtggcgcgttagccacaggaatggaa
aactccttgcagagcgcggttcgcgaccaggttcacagcaatacgcgggtacgatttcca
atggtgcgaaaaggctttcttgcgtcaccggaaaacccgcaaggcattcgtgggcaggat
gaatttgttcgcgtgagttgggatgaggcgctggatcttattcaccaacaacataaacgc
attcgtgaggcttatggtccggcatcgatttttgctggttcctacggctggcgttcaaac
ggcgtgctgcataaggcctcgacattattacaacgctatatggcgctggcaggcggttat
accgggcatctgggggattattcgaccggcgcggcacaggcgatcatgccgtatgtcgtg
ggtggtagtgaagtttatcaacagcagaccagttggccgctggtgctggaacatagcgat
gtcgtggtgctgtggagtgctaacccactcaatacgctgaaaattgcgtggaatgcatcc
gatgagcaggggctttcttacttttctgcactgcgtgacagcgggaaaaagctgatctgc
attgatccaatgcgatcggaaaccgtcgatttctttggcgataaaatggagtgggtggca
ccgcacatgggcaccgatgttgcgctgatgctggggatcgcccatacgctggtggaaaat
ggttggcacgacgaagcgtttctggcgcgttgcaccacaggttatgccgtcttcgcctct
tatttgctgggcgagagtgacggaatagcgaaaaccgccgaatgggcagcagagatttgt
ggtgttggcgcagcgaaaatccgcgagctggcggctattttccaccaaaataccaccatg
ctgatggcaggctggggaatgcagcgccaacagtttggtgagcaaaaacactggatgatc
gtcacgctggcagcaatgttggggcaaatcggcacacccggcggcggttttggtctttct
taccattttgccaatggtggtaaccccacgcggcgttctgcggtgctctcttccatgcag
ggcagcttgccgggtggctgcgatgcggtggataaaatccctgttgcccgcattgttgaa
gcactggaaaaccctggtggcgcatatcaacacaacggtatgaaccgacatttcccggat
attcgttttatctggtgggcgggcggtgccaactttactcatcatcaggataccaatcgc
ctgatccgtgcctggcaaaaaccggagctggtggtgatctctgaatgcttctggacggcg
gcggcaaaacacgcggatatcgttctgcctgcgactacctcttttgagcgtaatgatctc
accatgaccggtgattacagtaatcagcatctggtgccgatgaagcaagtggtgccgcca
cgctatgaagcgcgtaatgattttgatgtttttgccgagttaagtgaacgctgggagaag
ggcggttatgcacgttttacggaaggaaaaagtgagctgcaatggctggaaacgttttat
aacgttgcccgacagcgcggggcaagccagcaggttgaattgccgccatttgctgagttc
tggcaagccaaccagttaattgagatgccggaaaacccggacagcgagcggtttattcgc
ttcgctgatttttgccgcgatccgctggcgcatccgttaaaaaccgccagcggcaagatt
gaaatcttctcacagcgtattgccgattacggttacccggattgccctgggcatccaatg
tggctggagccggacgaatggcagggcaatgccgaaccagaacagttgcaggtactttct
gcccatccggcgcaccgcctgcacagccagctgaattacagttctctgcgcgaattgtac
gcggtggcaaatcgtgagcctgtcaccattcatcctgacgatgcccaggagcgcggcata
caagatggcgatactgttcggttgtggaacgcacgcgggcaaattcttgccggagcggtc
attagcgagggaattaaacctggcgtgatttgcattcacgaaggggcatggccggatctg
gatttaaccgctgacggtatttgtaaaaacggcgcagtgaacgtgctgaccaaagatctc
cccagctcgcggctggggaatggctgtgcgggtaatacggcgctggcatggctggaaaaa
tacaacggtccggaactgacacttacagcgtttgaaccaccggccagctcataa

DBGET integrated database retrieval system