KEGG   Escherichia coli K-12 MG1655: b3553Help
Entry
b3553             CDS       T00007                                 

Gene name
ghrB
Definition
(RefSeq) glyoxylate reductase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00030  Pentose phosphate pathway
eco00260  Glycine, serine and threonine metabolism
eco00620  Pyruvate metabolism
eco00630  Glyoxylate and dicarboxylate metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    b3553 (ghrB)
   00620 Pyruvate metabolism
    b3553 (ghrB)
   00630 Glyoxylate and dicarboxylate metabolism
    b3553 (ghrB)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b3553 (ghrB)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     b3553 (ghrB)
    1.1.1.81  hydroxypyruvate reductase
     b3553 (ghrB)
    1.1.1.215  gluconate 2-dehydrogenase
     b3553 (ghrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 948074
NCBI-ProteinID: NP_418009
Pasteur: yiaE
RegulonDB: ECK120002153
ECOCYC: EG12272
ASAP: ABE-0011604
UniProt: P37666 A0A387CRJ6
Position
3717310..3718284
Genome map
AA seq 324 aa AA seqDB search
MKPSVILYKALPDDLLQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVNAAL
LEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVE
VAERVKAGEWTASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHH
KEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAEQFAKMKSSAIFINAGRGPV
VDENALIAALQKGEIHAAGLDVFEQEPLSVDSPLLSMANVVAVPHIGSATHETRYGMAAC
AVDNLIDALQGKVEKNCVNPHVAD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccgttatcctctacaaagccttacctgatgatttactgcaacgcctgcaa
gagcatttcaccgttcaccaggtggcaaacctcagcccacaaaccgtcgaacaaaatgca
gcaatttttgccgaagctgaaggtttactgggttcaaacgagaatgtaaatgccgcattg
ctggaaaaaatgccgaaactgcgtgccacatcaacgatctccgtcggctatgacaatttt
gatgtcgatgcgcttaccgcccgaaaaattctgctgatgcacacgccaaccgtattaaca
gaaaccgtcgccgatacgctgatggcgctggtgttgtctaccgctcgtcgggttgtggag
gtagcagaacgggtaaaagcaggcgaatggaccgcgagcataggcccggactggtacggc
actgacgttcaccataaaacactgggcattgtcgggatgggacggatcggcatggcgctg
gcacaacgtgcgcactttggcttcaacatgcccatcctctataacgcgcgccgccaccat
aaagaagcagaagaacgcttcaacgcccgctactgcgatttggatactctgttacaagag
tcagatttcgtttgcctgatcctgccgttaactgatgagacgcatcatctgtttggcgca
gaacaattcgccaaaatgaaatcctccgccattttcattaatgccggacgtggcccggtg
gttgacgaaaatgcactgatcgcagcattgcagaaaggcgaaattcacgctgccgggctg
gatgtcttcgaacaagagccactgtccgtagattcgccgttgctctcaatggccaacgtc
gtcgcagtaccgcatattggatctgccacccatgagacgcgttatggcatggccgcctgt
gccgtggataatttgattgatgcgttacaaggaaaggttgagaagaactgtgtgaatccg
cacgtcgcggactaa

DBGET integrated database retrieval system