KEGG   Escherichia coli K-12 MG1655: b3618Help
Entry
b3618             CDS       T00007                                 

Gene name
htrL
Definition
(RefSeq) protein HtrL
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HtrL_YibB
Motif
Other DBs
NCBI-GeneID: 948137
NCBI-ProteinID: NP_418075
RegulonDB: ECK120001169
ASAP: ABE-0011838
UniProt: P25666
Position
complement(3792826..3793683)
Genome map
AA seq 285 aa AA seqDB search
MKSSTTIITAYFDIGRGDWTANKGFREKLARSVDVYFSYFERLAALENEMIIFTSPDLKP
RVEAIRNGKPTTVIVIDIKKKFRYIRSRIEKIQKDESFTNRLEPRQLKNPEYWSPEYVLV
CNLKAYFVNKAINMGLVKTPLVAWIDFGYCHKPNVTRGLKIWDFPFDESKMHLFTIKKGL
TVTSQQQVFDFMIGNHVYIIGGAIVGSQHKWKEFYKLVLESQKITLNNNIVDDDQGIFVM
CYYKRPDLFNLNYLGRGKWFDLFRCFRSNTLGAKMQALRIFLSRK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatccaccacaattatcactgcatattttgacattggtagaggggattggact
gctaataaagggttccgtgaaaaactagctcgttcagttgatgtttattttagttacttt
gagcgtctggccgcacttgaaaatgagatgattattttcacttctcccgatttgaaacca
agggttgaagcgattcgcaacggaaaaccaacaacggttatcgttatcgatataaaaaag
aaatttagatatatcagaagtcgtatcgaaaaaattcaaaaagatgagtcgtttacaaat
agacttgagcctcgacaattaaaaaacccagagtactggtcaccagagtatgttttggta
tgtaaccttaaggcctattttgtaaataaagctatcaacatgggcttagtgaaaacgcct
cttgttgcgtggatagattttggctattgccataagccaaatgtaactcgaggattgaaa
atttgggatttcccatttgatgaaagtaagatgcatcttttcactataaaaaaagggctt
actgtcacatctcaacaacaggtttttgatttcatgattggcaatcatgtatatattatt
gggggcgcaattgttggttcacagcataaatggaaagaattctataaattagttctggaa
agtcaaaaaataacactaaataataacattgtggacgatgaccagggcatttttgtcatg
tgctattacaaacgccccgatctcttcaacctaaactatctggggagaggaaaatggttc
gatttgtttcgctgcttcaggagtaacactttaggggcaaaaatgcaggcgctgagaatt
ttcctttcaagaaaatag

DBGET integrated database retrieval system