KEGG   Escherichia coli K-12 MG1655: b3657Help
Entry
b3657             CDS       T00007                                 

Gene name
yicJ
Definition
(RefSeq) putative xyloside transporter YicJ
  KO
K03292  glycoside/pentoside/hexuronide:cation symporter, GPH family
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    b3657 (yicJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_2
Motif
Other DBs
NCBI-GeneID: 948168
NCBI-ProteinID: NP_418114
Pasteur: yicJ
RegulonDB: ECK120001629
ECOCYC: EG11686
ASAP: ABE-0011953
UniProt: P31435
Position
complement(3834547..3835929)
Genome map
AA seq 460 aa AA seqDB search
MKSEVLSVKEKIGYGMGDAASHIIFDNVMLYMMFFYTDIFGIPAGFVGTMFLVARALDAI
SDPCMGLLADRTRSRWGKFRPWVLFGALPFGIVCVLAYSTPDLSMNGKMIYAAITYTLLT
LLYTVVNIPYCALGGVITNDPTQRISLQSWRFVLATAGGMLSTVLMMPLVNLIGGDNKPL
GFQGGIAVLSVVAFMMLAFCFFTTKERVEAPPTTTSMREDLRDIWQNDQWRIVGLLTIFN
ILAVCVRGGAMMYYVTWILGTPEVFVAFLTTYCVGNLIGSALAKPLTDWKCKVTIFWWTN
ALLAVISLAMFFVPMQASITMFVFIFVIGVLHQLVTPIQWVMMSDTVDYGEWCNGKRLTG
ISFAGTLFVLKLGLAFGGALIGWMLAYGGYDAAEKAQNSATISIIIALFTIVPAICYLLS
AIIAKRYYSLTTHNLKTVMEQLAQGKRRCQQQFTSQEVQN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgaagtgttgtccgttaaagagaaaattggttatggcatgggagacgccgcc
agccacattattttcgataacgtaatgttatatatgatgttcttttataccgatattttt
ggcattcctgccggttttgtcggaaccatgtttttggtcgctcgtgcactggatgcgatt
tccgatccttgcatggggttgttggccgatcgaacgcgctctcgctggggtaaatttcgt
ccgtgggtactgtttggcgcactgccattcgggatcgtctgtgtactggcctatagcacg
ccagatctcagtatgaacggcaaaatgatctatgcagcaattacttacaccctacttacc
ttactttataccgtcgtcaatatcccttactgcgcattgggtggtgtaatcaccaatgac
ccgactcagcgtatctcgctgcaatcctggcgttttgtgctggcgaccgcgggaggcatg
ctttctactgttctgatgatgccactggttaatttaattggcggtgataataaaccactc
ggtttccagggcggtatcgcggtcctttccgtggtggcattcatgatgctggcattttgt
ttcttcaccactaaagaacgcgttgaagcaccacctacaacaacgtctatgcgggaagat
ttacgtgatatctggcaaaacgaccagtggcggattgtcggtttactaaccattttcaat
atcctggcggtgtgcgtacgcggtggggcgatgatgtattacgtcacatggattttgggc
acgccggaagtgtttgtcgcttttctcaccacttattgcgtgggtaacctgattggttcc
gcactggcaaaacctctgaccgactggaaatgtaaagtcactatcttctggtggacgaac
gccctgctggcagtgattagcctcgcgatgttctttgttcccatgcaggccagcatcact
atgtttgtcttcatcttcgtgattggtgtgttgcatcaactggtgacacctatccagtgg
gtaatgatgtccgataccgtcgactacggcgagtggtgcaatggtaaacgcctgaccggg
atcagttttgctggcacgctgtttgtgctcaaactggggttggccttcggcggcgctctt
atcggctggatgctggcttatggcggatatgatgcggcagaaaaagcgcagaacagcgcc
acgattagcatcattattgcgctattcacgattgttccggcgatctgttatttgctgagc
gcgattatcgctaaacgctactactcactcacgacgcacaatctgaaaaccgttatggaa
cagctggctcagggtaaacgccgttgccagcaacaattcacctctcaagaagtgcagaac
taa

DBGET integrated database retrieval system