KEGG   Escherichia coli K-12 MG1655: b3659Help
Entry
b3659             CDS       T00007                                 

Gene name
setC
Definition
(RefSeq) putative arabinose exporter
  KO
K03291  MFS transporter, SET family, sugar efflux transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3659 (setC)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Sugar transporters
   Sugar efflux transporter (SET) [TC:2.A.1.20]
    b3659 (setC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 948177
NCBI-ProteinID: NP_418115
Pasteur: yicK
RegulonDB: ECK120001630
ECOCYC: EG11687
ASAP: ABE-0011959
UniProt: P31436 A0A387CR81
Position
3836953..3838137
Genome map
AA seq 394 aa AA seqDB search
MQKTATTPSKILDLTAAAFLLVAFLTGIAGALQTPTLSIFLADELKARPIMVGFFFTGSA
IMGILVSQFLARHSDKQGDRKLLILLCCLFGVLACTLFAWNRNYFILLSTGVLLSSFAST
ANPQMFALAREHADRTGRETVMFSTFLRAQISLAWVIGPPLAYELAMGFSFKVMYLTAAI
AFVVCGLIVWLFLPSIQRNIPVVTQPVEILPSTHRKRDTRLLFVVCSMMWAANNLYMINM
PLFIIDELHLTDKLTGEMIGIAAGLEIPMMLIAGYYMKRIGKRLLMLIAIVSGMCFYASV
LMATTPAVELELQILNAIFLGILCGIGMLYFQDLMPEKIGSATTLYANTSRVGWIIAGSV
DGIMVEIWSYHALFWLAIGMLGIAMICLLFIKDI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaacggctaccactccatcaaaaatacttgatctcactgccgcggcattttta
cttgtcgcctttctgacgggtattgcgggcgctcttcagactcctaccctaagtatattc
ctcgcagatgaactgaaagcccgtcctataatggtaggttttttcttcaccggtagcgct
attatgggaattctggtcagtcaatttctggcaaggcactccgataaacaaggcgaccgt
aaattactgattctgctatgttgcttatttggagtgctggcctgcacgctttttgcgtgg
aatcgcaactacttcattctcctctcaacgggcgtacttctgagtagttttgcttccacc
gcaaacccgcaaatgttcgccctcgcccgtgaacacgccgacagaacaggccgtgagacg
gtcatgttcagtacatttttacgtgctcagatctcgcttgcctgggttatcgggccaccg
ctcgcttatgaactggcaatgggatttagttttaaagtgatgtatctcaccgctgccatc
gcatttgttgtttgcggactgatagtctggttgtttttgccatcaatacaaagaaatatt
cctgtcgttacccaacccgtagaaattttaccctccacccacaggaagcgggatacgcgg
ctactttttgtggtctgttcaatgatgtgggcggcgaataatctctacatgataaatatg
ccgctatttattattgatgaactgcatctaaccgataaactgactggagaaatgattggt
atcgctgccggtctggaaattccgatgatgttaatcgcaggctattacatgaaacgtatt
ggcaagcgactattaatgctcattgctatcgtgagtggaatgtgtttttacgccagcgta
ctcatggcgacgactccggcggttgagctggaattgcaaattcttaatgccatcttcctt
ggtattctctgtggtatcggcatgctttattttcaggacttgatgcctgaaaaaataggc
tctgcgacaacgttatatgcaaatacttcacgcgtcggctggattatcgccggctctgtt
gacggaattatggttgaaatctggagctaccatgcgttgttctggctggcgatagggatg
ttgggtattgcgatgatttgcctgctgtttattaaagatatttag

DBGET integrated database retrieval system