KEGG   Escherichia coli K-12 MG1655: b3660Help
Entry
b3660             CDS       T00007                                 

Gene name
yicL
Definition
(RefSeq) putative inner membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA QCR10
Motif
Other DBs
NCBI-GeneID: 948176
NCBI-ProteinID: NP_418116
Pasteur: yicL
RegulonDB: ECK120001631
ECOCYC: EG11688
ASAP: ABE-0011962
UniProt: P31437 A0A387CNA2
Position
3838248..3839171
Genome map
AA seq 307 aa AA seqDB search
MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEQSQMSSQFLTMTRLIFAGLILLTLSFVHGD
KIFSIINNHKDAISLLIFSVVGALTVQLTFLLTIEKSNAATATVLQFLSPTIIVAWFSLV
RKSRPGILVFCAILTSLVGTFLLVTHGNPTSLSISPAALFWGIASAFAAAFYTTYPSTLI
ARYGTLPVVGWSMLIGGLILLPFYARQGTNFVVNGSLILAFFYLVVIGTSLTFSLYLKGA
QLIGGPKASILSCAEPLSSALLSLLLLGITFTLPDWLGTLLILSSVILISMDSRRRARKI
NRPARHK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggttccaccagaaaggggatgctgaacgttctgattgccgccgtgttgtggggaagt
tcaggggtctgcgcgcaatacatcatggagcaaagccagatgtcgtcgcagtttttgact
atgacgcgtttgatattcgccggtttgattctactgacgctgtcatttgttcatggcgat
aaaatcttttctattattaacaatcataaagatgccattagcctgctgattttttccgtg
gttggcgcgctaactgtacagctcacttttttgctaaccatcgaaaaatcgaacgcagcc
acggcaacggtgctgcaattcctctcaccgacgattatcgtcgcctggttctcactggtg
cgtaaatcgcgcccgggcattctggttttctgcgctattttgacatcgctggtcgggact
tttttattggtgacacacggtaatccgacgtcattatcgatctctcctgccgcgttgttc
tggggcattgcctcggcatttgctgctgcattctataccacctatccctcaacgctaatt
gcccgctatggcacgttaccagtcgtcggctggagtatgctgattggcggtctgattctg
ttgcctttttatgccagacaaggaacaaactttgtcgttaacggcagtttgattctggcg
tttttttatttggtggtcattggtacgtccctgacatttagtctgtacctgaaaggagca
caattaattggcggtccaaaagccagcattttgagctgtgcagaaccattaagtagcgcg
ctactctctttgctgttgctggggatcacgttcacattaccggactggctgggaacgctg
ctgattctgtcatcggtgattttgatttcaatggattcccgtcgccgcgccagaaaaata
aatcgtccggcgcggcataagtga

DBGET integrated database retrieval system