KEGG   Escherichia coli K-12 MG1655: b3691Help
Entry
b3691             CDS       T00007                                 

Gene name
dgoT
Definition
(RefSeq) D-galactonate transporter
  KO
K08194  MFS transporter, ACS family, D-galactonate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    b3691 (dgoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr SPC12
Motif
Other DBs
NCBI-GeneID: 948196
NCBI-ProteinID: NP_418146
Pasteur: dgoT
RegulonDB: ECK120002440
ECOCYC: EG20053
ASAP: ABE-0012072
UniProt: P0AA76
Position
complement(3870438..3871730)
Genome map
AA seq 430 aa AA seqDB search
MDIPVNAAKPGRRRYLTLVMIFITVVICYVDRANLAVASAHIQEEFGITKAEMGYVFSAF
AWLYTLCQIPGGWFLDRVGSRVTYFIAIFGWSVATLFQGFATGLMSLIGLRAITGIFEAP
AFPTNNRMVTSWFPEHERASAVGFYTSGQFVGLAFLTPLLIWIQEMLSWHWVFIVTGGIG
IIWSLIWFKVYQPPRLTKGISKAELDYIRDGGGLVDGDAPVKKEARQPLTAKDWKLVFHR
KLIGVYLGQFAVASTLWFFLTWFPNYLTQEKGITALKAGFMTTVPFLAAFVGVLLSGWVA
DLLVRKGFSLGFARKTPIICGLLISTCIMGANYTNDPMMIMCLMALAFFGNGFASITWSL
VSSLAPMRLIGLTGGVFNFAGGLGGITVPLVVGYLAQGYGFAPALVYISAVALIGALSYI
LLVGDVKRVG
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatattcccgttaatgcagcaaagccggggcgtcggcgttatctgacgctggtgatg
atctttattacggtagtcatttgttatgtcgaccgcgccaacctggccgtggcttccgcc
catattcaggaagagttcggcattaccaaagcggaaatgggctatgtattttcggccttc
gcctggctttatacgctatgtcagatccccggcggttggtttttagatcgcgtaggttct
cgcgtgacttattttattgcgatatttggctggtcagtggcgactttattccagggcttt
gccacgggcttaatgtcattaattggtctgcgcgcgataaccggtattttcgaagcgcct
gctttcccgaccaataaccggatggtgaccagctggttcccggaacatgaacgcgcttct
gccgttggtttttatacgtctggtcagtttgtcggtctggcgtttctgacgccgctgctg
atctggattcaggagatgttgagctggcactgggtgttcattgtcactggtggtatcggc
attatctggtcgctgatttggtttaaggtttatcagccgccgcgcctgaccaaaggtatc
agcaaagctgaactggattacattcgtgatggcggcggtctggtggatggtgatgcgccg
gtgaagaaagaggcgcgtcagccgttaacagccaaagactggaaactggtgttccatcgt
aaactgatcggcgtttatcttgggcaatttgcggtggcttctacactgtggtttttctta
acctggttcccgaactatttaacccaggaaaaaggaatcacggcgctgaaagcaggcttt
atgaccacggtgccattcctcgcggcgtttgtcggcgtcctgctctctggctgggtagcg
gatctgctggtacgtaagggcttttcactgggctttgcgcgtaaaacgccgattatctgc
ggcttgctgatctccacctgcattatgggcgctaactacactaacgatccgatgatgatt
atgtgcctgatggcgctggcattcttcggtaacggttttgcttcgattacctggtcgctg
gtttcttctctggcaccgatgcgcctgattggtttaaccggcggcgtgtttaacttcgcc
ggtggtctgggcggcatcaccgttccgctggtggtggggtacctggcgcagggttacggt
ttcgcacctgcactggtttatatctccgccgtcgcgttgattggcgcgctctcttatatc
ctgctggtgggcgatgtgaagcgcgttggctaa

DBGET integrated database retrieval system