KEGG   Escherichia coli K-12 MG1655: b3697Help
Entry
b3697             CDS       T00007                                 

Gene name
yidA
Definition
(RefSeq) sugar phosphate phosphatase
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase Hydrolase_6 HAD_2 HAD Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 948204
NCBI-ProteinID: NP_418152
Pasteur: yidA
RegulonDB: ECK120001176
ECOCYC: EG11195
ASAP: ABE-0012086
UniProt: P0A8Y5
Structure
PDB: 

Position
complement(3876140..3876952)
Genome map
AA seq 270 aa AA seqDB search
MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARARGVNVVLTTGRPYAGVHNYLKELHME
QPGDYCITYNGALVQKAADGSTVAQTALSYDDYRFLEKLSREVGSHFHALDRTTLYTANR
DISYYTVHESFVATIPLVFCEAEKMDPNTQFLKVMMIDEPAILDQAIARIPQEVKEKYTV
LKSAPYFLEILDKRVNKGTGVKSLADVLGIKPEEIMAIGDQENDIAMIEYAGVGVAMDNA
IPSVKEVANFVTKSNLEDGVAFAIEKYVLN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctattaaactcattgctatcgatatggatggcacccttctgctgcccgatcacacc
atttcacccgccgttaaaaatgcgattgccgcagctcgcgcccgtggcgtgaatgtcgtg
ctaacgacgggtcgcccgtatgcaggtgtgcacaactacctgaaagagctgcatatggaa
cagccgggcgactactgcattacttataacggcgcgctggtacagaaggccgctgatggt
agcaccgtggcgcaaactgctctcagctatgacgactatcgtttcctggaaaaactctct
cgcgaagtcggttctcatttccacgccctggaccgcaccacgctgtacaccgccaaccgt
gatatcagctactacacggtgcatgaatccttcgttgccaccattccgctggtgttctgc
gaagcggagaaaatggaccccaatacccagttcctgaaagtgatgatgattgatgaaccc
gccatcctcgaccaggctatcgcgcgtattccgcaggaagtgaaagagaaatataccgtg
ctgaaaagtgcgccgtacttcctcgaaatcctcgataaacgcgttaacaaaggtacgggg
gtgaaatcactggccgacgtgttaggtattaaaccggaagaaatcatggcgattggcgat
caggaaaacgatatcgcaatgattgaatatgcaggcgtcggtgtggcgatggataacgct
attccttcagtgaaagaagtggcgaactttgtcaccaaatctaaccttgaagatggcgtg
gcgtttgctattgagaagtatgtgctgaattaa

DBGET integrated database retrieval system