KEGG   Escherichia coli K-12 MG1655: b3708Help
Entry
b3708             CDS       T00007                                 

Gene name
tnaA
Definition
(RefSeq) tryptophanase
  KO
K01667  tryptophanase [EC:4.1.99.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00380  Tryptophan metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    b3708 (tnaA)
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.1  tryptophanase
     b3708 (tnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 SepSecS
Motif
Other DBs
NCBI-GeneID: 948221
NCBI-ProteinID: NP_418164
Pasteur: tnaA
RegulonDB: ECK120000994
ECOCYC: EG11005
ASAP: ABE-0012133
UniProt: P0A853
Structure
PDB: 

Position
3888730..3890145
Genome map
AA seq 471 aa AA seqDB search
MENFKHLPEPFRIRVIEPVKRTTRAYREEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVT
QSMQAAMMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQE
KGLDRSKMVAFSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYDFKGNFDLEGLERGI
EEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQ
REAEYKDWTIEQITRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLCVV
QEGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAA
FVDAGKLLPHIPADQFPAQALACELYKVAGIRAVEIGSFLLGRDPKTGKQLPCPAELLRL
TIPRATYTQTHMDFIIEAFKHVKENAANIKGLTFTYEPKVLRHFTAKLKEV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactttaaacatctccctgaaccgttccgcattcgtgttattgagccagtaaaa
cgtaccactcgcgcttatcgtgaagaggcaattattaaatccggtatgaacccgttcctg
ctggatagcgaagatgtttttatcgatttactgaccgacagcggcaccggggcggtgacg
cagagcatgcaggctgcgatgatgcgcggcgacgaagcctacagcggcagtcgtagctac
tatgcgttagccgagtcagtgaaaaatatctttggttatcaatacaccattccgactcac
cagggccgtggcgcagagcaaatctatattccggtactgattaaaaaacgcgagcaggaa
aaaggcctggatcgcagcaaaatggtggcgttctctaactatttctttgataccacgcag
ggccatagccagatcaacggctgtaccgtgcgtaacgtctatatcaaagaagccttcgat
acgggcgtgcgttacgactttaaaggcaactttgaccttgagggattagaacgcggtatt
gaagaagttggtccgaataacgtgccgtatatcgttgcaaccatcaccagtaactctgca
ggtggtcagccggtttcactggcaaacttaaaagcgatgtacagcatcgcgaagaaatac
gatattccggtggtaatggactccgcgcgctttgctgaaaacgcctatttcatcaagcag
cgtgaagcagaatacaaagactggaccatcgagcagatcacccgcgaaacctacaaatat
gccgatatgctggcgatgtccgccaagaaagatgcgatggtgccgatgggcggcctgctg
tgcatgaaagacgacagcttctttgatgtgtacaccgagtgcagaaccctttgcgtggtg
caggaaggcttcccgacatatggcggcctggaaggcggcgcgatggagcgtctggcggta
ggtctgtatgacggcatgaatctcgactggctggcttatcgtatcgcgcaggtacagtat
ctggtcgatggtctggaagagattggcgttgtctgccagcaggcgggcggtcacgcggca
ttcgttgatgccggtaaactgttgccgcatatcccggcagaccagttcccggcacaggcg
ctggcctgcgagctgtataaagtcgccggtatccgtgcggtagaaattggctctttcctg
ttaggccgcgatccgaaaaccggtaaacaactgccatgcccggctgaactgctgcgttta
accattccgcgcgcaacatatactcaaacacatatggacttcattattgaagcctttaaa
catgtgaaagagaacgcggcgaatattaaaggattaacctttacgtacgaaccgaaagta
ttgcgtcacttcaccgcaaaacttaaagaagtttaa

DBGET integrated database retrieval system