KEGG   Escherichia coli K-12 MG1655: b3750Help
Entry
b3750             CDS       T00007                                 

Gene name
rbsC
Definition
(RefSeq) D-ribose ABC transporter permease
  KO
K10440  ribose transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Module
eco_M00212  Ribose transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3750 (rbsC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    b3750 (rbsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-GeneID: 948262
NCBI-ProteinID: NP_418206
Pasteur: rbsC
RegulonDB: ECK120000807
ECOCYC: EG10816
ASAP: ABE-0012261
UniProt: P0AGI1
Position
3935288..3936253
Genome map
AA seq 321 aa AA seqDB search
MTTQTVSGRRYFTKAWLMEQKSLIALLVLIAIVSTLSPNFFTINNLFNILQQTSVNAIMA
VGMTLVILTSGIDLSVGSLLALTGAVAASIVGIEVNALVAVAAALALGAAIGAVTGVIVA
KGRVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFTENADLFGWFGIGRPLGVPTPVWIMG
IVFLAAWYMLHHTRLGRYIYALGGNEAATRLSGINVNKIKIIVYSLCGLLASLAGIIEVA
RLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSY
YQMIVKAVVILLAVLVDNKKQ
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccagactgtctctggtcgccgttatttcacgaaagcgtggctgatggagcag
aaatcgcttatcgctctgctggtgctgatcgcgattgtctcgacgttaagcccgaacttt
ttcaccatcaataacttattcaatattctccagcaaacctcagtgaacgccattatggcg
gtcgggatgacgctggtgatcctgacgtcgggcatcgacttatcggtaggttctctgttg
gcgctgaccggcgcagttgctgcatctatcgtcggcattgaagtcaatgcgctggtggct
gtcgctgctgctctcgcgttaggtgccgcaattggtgcggtaaccggggtgattgtagcg
aaaggtcgcgtccaggcgtttatcgctacgctggttatgatgcttttactgcgcggcgtg
accatggtttataccaacggtagcccagtgaataccggctttactgagaacgccgatctg
tttggctggtttggtattggtcgtccgctgggcgtaccgacgccagtctggatcatgggg
attgtcttcctcgcggcctggtacatgctgcatcacacgcgtctggggcgttacatctac
gcgctgggcggcaacgaagcggcaacgcgtctttctggtatcaacgtcaataaaatcaaa
atcatcgtctattctctttgtggtctgctggcatcgctggccgggatcattgaagtggcg
cgtctctcctccgcacaacccacggcggggactggctatgagctggatgctattgctgcg
gtggttctgggcggtacgagtctggcgggcggaaaaggtcgcattgttgggacgttgatc
ggcgcattaattcttggcttccttaataatggattgaatttgttaggtgtttcctcctat
taccagatgatcgtcaaagcggtggtgattttgctggcggtgctggtagacaacaaaaag
cagtaa

DBGET integrated database retrieval system