KEGG   Escherichia coli K-12 MG1655: b3780Help
Entry
b3780             CDS       T00007                                 

Gene name
rhlB
Definition
(RefSeq) ATP-dependent RNA helicase
  KO
K03732  ATP-dependent RNA helicase RhlB [EC:3.6.4.13]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03018  RNA degradation
Module
eco_M00394  RNA degradosome
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    b3780 (rhlB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     b3780 (rhlB)
Messenger RNA biogenesis [BR:eco03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     b3780 (rhlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C AAA_22
Motif
Other DBs
NCBI-GeneID: 948290
NCBI-ProteinID: NP_418227
Pasteur: rhlB
RegulonDB: ECK120000835
ECOCYC: EG10844
ASAP: ABE-0012351
UniProt: P0A8J8
Position
complement(3964365..3965630)
Genome map
AA seq 421 aa AA seqDB search
MSKTHLTEQKFSDFALHPKVVEALEKKGFHNCTPIQALALPLTLAGRDVAGQAQTGTGKT
MAFLTSTFHYLLSHPAIADRKVNQPRALIMAPTRELAVQIHADAEPLAEATGLKLGLAYG
GDGYDKQLKVLESGVDILIGTTGRLIDYAKQNHINLGAIQVVVLDEADRMYDLGFIKDIR
WLFRRMPPANQRLNMLFSATLSYRVRELAFEQMNNAEYIEVEPEQKTGHRIKEELFYPSN
EEKMRLLQTLIEEEWPDRAIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILD
EFTRGDLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDYVHRIGRTGRAGASGHSISLA
CEEYALNLPAIETYIGHSIPVSKYNPDALMTDLPKPLRLTRPRTGNGPRRTGAPRNRRRS
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacacatttaacagaacagaagttttccgacttcgccctgcatccgaaggtt
gtagaagcccttgaaaaaaaagggtttcataactgtacgcccattcaggcactggccctt
ccgctgacgctggcgggtcgtgacgtagccgggcaggcgcaaaccggtaccgggaaaacg
atggcgtttcttacgtcaacgtttcattatcttctctctcatcctgcgattgccgatcgc
aaggtgaatcagccgcgtgccttaattatggcaccgacgcgtgaacttgccgtgcagatc
catgccgacgcagaaccgctggcggaagctactggcctgaagctgggtctggcttacggt
ggtgatggctacgacaaacagctgaaagtgctggaaagcggcgttgacattctgattggc
accacggggcgtttaattgactacgccaagcagaaccacattaacctcggtgccattcag
gtggtggtactggacgaagccgatcgcatgtacgatctgggctttattaaagatatccgc
tggctgttccgccgtatgccgcctgcaaaccagcgcctcaacatgctgttctccgccacg
ctttcgtaccgggtacgtgaactggcgttcgagcagatgaacaatgccgaatatattgaa
gtggaaccggaacagaaaacgggccaccgtattaaagaagagcttttctacccttctaac
gaagaaaaaatgcgtttgctgcaaacgctgatcgaagaagagtggccagacagagcgatt
attttcgccaacaccaaacaccgttgtgaagagatctggggccacctggcagcagatggt
catcgtgtcggtttattgacaggcgatgtcgcgcagaaaaaacgtctgcgtattcttgat
gaatttacccgtggcgatctggatattctggttgccaccgacgttgccgcgcgtggtttg
catattccggcagtgacgcacgtctttaactacgatttacccgatgactgtgaagattac
gttcaccgtattggtcgtacaggtcgcgcaggcgcaagcggtcactctatcagcctggcg
tgtgaagagtatgcattgaatttgcctgctattgagacctatattggtcactcaattccg
gtaagcaaatacaatccggacgcattgatgaccgatctgccaaaaccgctgcgcctcacg
cgcccgcgcacaggcaatggtccgcgtcgtactggcgctccgcgtaatcgtcgtcgttca
ggttaa

DBGET integrated database retrieval system