KEGG   Escherichia coli K-12 MG1655: b3793
Entry
b3793             CDS       T00007                                 

Gene name
wzyE
Definition
(RefSeq) enterobacterial common antigen polymerase
  KO
K02853  enterobacterial common antigen polymerase [EC:2.4.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eco01003]
    b3793 (wzyE)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     b3793 (wzyE)
Glycosyltransferases [BR:eco01003]
 Polysaccharide
  Bacterial polysaccharide
   b3793 (wzyE)
SSDB
Motif
Pfam: WzyE
Other DBs
NCBI-GeneID: 948293
NCBI-ProteinID: NP_418241
Pasteur: rffT
RegulonDB: ECK120001420
ECOCYC: EG11457
ASAP: ABE-0012392
UniProt: P27835
Position
3978601..3979953
AA seq 450 aa
MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVRFNFNVFFSLLFLLTFFFGFPLTSVLVFR
FDVGVAPPEILLQALLSAGCFYAVYYVTYKTRLRKRVADVPRRPLFTMNRVETNLTWVIL
MGIALVSVGIFFMHNGFLLFRLNSYSQIFSSEVSGVALKRFFYFFIPAMLVVYFLRQDSK
AWLFFLVSTVAFGLLTYMIVGGTRANIIIAFAIFLFIGIIRGWISLWMLAAAGVLGIVGM
FWLALKRYGMNVSGDEAFYTFLYLTRDTFSPWENLALLLQNYDNIDFQGLAPIVRDFYVF
IPSWLWPGRPSMVLNSANYFTWEVLNNHSGLAISPTLIGSLVVMGGALFIPLGAIVVGLI
IKWFDWLYELGNREPNRYKAAILHSFCFGAIFNMIVLAREGLDSFVSRVVFFIVVFGACL
MIAKLLYWLFESAGLIHKRTKSSLRTQVEG
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgagtctgctgcaattcagtggcctgtttgttgtctggctgctctgcacgctgtttatt
gccacgctgacctggtttgagtttcgccgtgtgcgctttaacttcaatgtcttcttttca
ttgctgtttttgctcacctttttcttcggcttcccgctgaccagcgtgctggtatttcgc
tttgatgttggtgtcgcgccgccagaaatcttgttgcaggcgttgctttctgcgggctgc
ttctacgcggtttactatgtcacctacaaaacccgcctacgcaaacgcgttgctgatgta
ccgcgccgtccgctgtttaccatgaaccgcgtggagaccaatcttacgtgggtgatcctg
atgggtatcgcgctggtaagcgtcggcatcttcttcatgcacaacggctttttgctgttc
cggcttaactcctacagtcagatcttttccagtgaagtctccggcgtggcgttaaaacgc
ttcttttactttttcatcccggcgatgctggtggtctactttctgcgccaggacagcaaa
gcgtggctgtttttcctcgtcagcacggtcgcctttggcttgctgacttatatgattgtc
ggcggcactcgcgccaatatcatcatcgcattcgctatcttcctgtttattggcattatt
cgcggctggatttcgttgtggatgctggcggcggcgggcgtgctggggattgttggcatg
ttctggctggcactaaaacgctatggaatgaatgtgagcggcgatgaagcgttctatacg
tttctctatctcactcgcgacaccttctcgccgtgggagaatctggcgttgctgttgcag
aactacgacaacatcgacttccagggcctggctccaattgtccgcgatttctatgtcttt
atcccttcctggctgtggccgggtcgcccgagtatggtgctgaactcagccaactacttt
acctgggaagtgctgaataaccactccggactggcgatctcgcctacgcttataggctca
ctggtggtgatgggcggcgcgttgttcatcccgctcggggcgatcgtggttggtctgatc
atcaaatggttcgactggctgtatgagctgggcaaccgcgagcctaatcgctataaagct
gcgatattgcacagtttctgctttggggcgatcttcaatatgatcgtgctggcgcgtgaa
gggctggattcgtttgtctcacgcgtggtcttttttatcgtggtcttcggcgcatgtctg
atgatcgcaaaactgttgtactggctttttgaaagcgccggactcattcataaacgtaca
aaatcatcgctccggacgcaggttgaaggataa

DBGET integrated database retrieval system