KEGG   Escherichia coli K-12 MG1655: b3795
Entry
b3795             CDS       T00007                                 

Symbol
yifK
Name
(RefSeq) putative transporter YifK
  KO
K03293  amino acid transporter, AAT family
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    b3795 (yifK)
SSDB
Motif
Pfam: AA_permease AA_permease_2
Other DBs
NCBI-GeneID: 945400
NCBI-ProteinID: YP_026258
Pasteur: yifK
RegulonDB: ECK120001422
ECOCYC: EG11459
ASAP: ABE-0012397
UniProt: P27837
Position
3980887..3982272
AA seq 461 aa
MADNKPELQRGLEARHIELIALGGTIGVGLFMGAASTLKWAGPSVLLAYIIAGLFVFFIM
RSMGEMLFLEPVTGSFAVYAHRYMSPFFGYLTAWSYWFMWMAVGISEITAIGVYVQFWFP
EMAQWIPALIAVALVALANLAAVRLYGEIEFWFAMIKVTTIIVMIVIGLGVIFFGFGNGG
QSIGFSNLTEHGGFFAGGWKGFLTALCIVVASYQGVELIGITAGEAKNPQVTLRSAVGKV
LWRILIFYVGAIFVIVTIFPWNEIGSNGSPFVLTFAKIGITAAAGIINFVVLTAALSGCN
SGMYSCGRMLYALAKNRQLPAAMAKVSRHGVPVAGVAVSIAILLIGSCLNYIIPNPQRVF
VYVYSASVLPGMVPWFVILISQLRFRRAHKAAIASHPFRSILFPWANYVTMAFLICVLIG
MYFNEDTRMSLFVGIIFMLAVTAIYKVFGLNRHGKAHKLEE
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggcagataacaaaccagagctacagcgtgggctggaagctcgacatatcgaactcatc
gccctggggggcaccattggcgtcggcctgtttatgggggccgccagtaccctgaaatgg
gccgggccatccgtattgttggcctatatcatcgccgggctgttcgtctttttcatcatg
cgttcaatgggcgaaatgttgttcctcgaaccggttaccggttcgttcgccgtttatgcg
catcgttatatgagcccgttctttggctatctcaccgcctggtcttactggtttatgtgg
atggcggtggggatctctgaaatcaccgccattggcgtttatgtccagttctggttcccg
gagatggcgcagtggatacccgcattgatcgcagtggcgctggtggcgttggcgaatctg
gcggcggtgcggttgtacggcgaaatcgagttctggttcgcgatgatcaaagtcaccacg
attatcgtgatgattgtcattggcctgggcgtgattttctttggctttggcaatggcggg
cagtcgattggttttagcaatctcacagagcatggcggtttctttgcgggtggctggaaa
gggttcctgaccgctctgtgtattgtggtggcgtcctaccagggcgtggagctgattggc
attactgccggtgaagcgaagaatccgcaggtgacgctgcgcagtgccgtaggcaaggtg
ctgtggcggatcctgattttctacgtaggcgcgattttcgttatcgtcaccatcttcccg
tggaatgaaataggcagcaacggcagcccgttcgtactgacttttgccaaaatcggtatt
accgcagcggcgggcattatcaactttgtggtgctgacggctgcgctctctggctgtaac
agcggcatgtacagttgcggacgtatgctctacgcactggcgaaaaaccgtcagttaccg
gcggcaatggcgaaagtttcccgtcacggcgtaccggttgcgggtgtggcagtatctatt
gctattctgctaattggctcatgcctgaactacatcattcccaatccgcagcgtgtgttt
gtctacgtctacagtgccagcgtgcttccggggatggtgccatggtttgtgatattgata
agccagctgcgttttcggcgtgcacataaagcggcgattgccagccatccgttccgctca
atcctgttcccgtgggccaattacgtaacaatggcattcctgatttgcgttttgatcggc
atgtactttaatgaagatacgcgtatgtcgctgtttgttggcatcatctttatgctggcg
gtgacggcgatttataaagtttttggccttaatcgccacgggaaagcgcataaactggag
gaataa

DBGET integrated database retrieval system