KEGG   Escherichia coli K-12 MG1655: b3802Help
Entry
b3802             CDS       T00007                                 

Gene name
hemY
Definition
(RefSeq) protein HemY
  KO
K02498  HemY protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    b3802 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemY_N TPR_2 TPR_19 TPR_14 TPR_16 TPR_1 MAS20 Suf TPR_11 Claudin_3 DUF4834
Motif
Other DBs
NCBI-GeneID: 948311
NCBI-ProteinID: NP_418246
Pasteur: hemY
RegulonDB: ECK120000427
ECOCYC: EG10434
ASAP: ABE-0012417
UniProt: P0ACB7
Position
complement(3986686..3987882)
Genome map
AA seq 398 aa AA seqDB search
MLKVLLLFVLLIAGIVVGPMIAGHQGYVLIQTDNYNIETSVTGLAIILILAMVVLFAIEW
LLRRIFRTGAHTRGWFVGRKRRRARKQTEQALLKLAEGDYQQVEKLMAKNADHAEQPVVN
YLLAAEAAQQRGDEARANQHLERAAELAGNDTIPVEITRVRLQLARNENHAARHGVDKLL
EVTPRHPEVLRLAEQAYIRTGAWSSLLDIIPSMAKAHVGDEEHRAMLEQQAWIGLMDQAR
ADNGSEGLRNWWKNQSRKTRHQVALQVAMAEHLIECDDHDTAQQIIIDGLKRQYDDRLLL
PIPRLKTNNPEQLEKVLRQQIKNVGDRPLLWSTLGQSLMKHGEWQEASLAFRAALKQRPD
AYDYAWLADALDRLHKPEEAAAMRRDGLMLTLQNNPPQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagtgttattgctctttgtgttgctgattgcggggatcgtggttggcccgatg
attgccggccatcagggttatgtgctgatccagaccgacaactacaatatcgaaaccagc
gtcacgggcctggcgatcatattgattctggcgatggtagtgctgtttgccattgagtgg
ctactgcggcggatcttccgcactggcgcgcacacccgtgggtggtttgtcggacgtaag
cgtcgccgtgcacgtaagcagaccgaacaggcgctgctgaaactggcggaaggcgattat
cagcaagttgaaaagctgatggcgaaaaatgccgatcacgcggaacaaccggtggtgaac
tatctactggctgccgaagccgcgcaacaacgtggtgatgaagcacgcgccaaccaacat
ctggaacgcgcagcggagctggccggcaacgacaccattccggtagaaatcacccgcgta
cgtctgcaactggcccgtaatgaaaaccatgctgcacgccacggcgtggataagctgctg
gaagttacgccacgccatccggaagtattacgtctggcggaacaggcgtatatccgcaca
ggtgcatggagttcgctgctggatattatcccatcaatggcgaaagcccatgttggtgat
gaagaacatcgtgcaatgctggaacaacaggcatggattggcctgatggatcaggcgcgt
gccgataacggtagcgaaggtttgcgtaactggtggaaaaaccaaagccggaaaacgcgt
catcaggtagcgttgcaggtggcaatggcggaacatcttattgaatgtgacgatcatgat
actgcccagcaaattatcatcgatggcctgaaacgccagtacgacgatcgcctactgctg
ccgattcctcgactgaaaacaaacaatccggaacagctggaaaaagtgctgcgccagcaa
atcaaaaacgtcggcgatcgcccgctgttgtggagcacactgggccagtcactgatgaag
cacggagaatggcaggaagcatcgctcgccttccgcgcagcgctgaaacaacgtccggac
gcctacgattacgcatggcttgccgacgcgctggacagactgcacaagccggaagaagct
gcagctatgcgtcgcgacggtttgatgttaacgttgcagaataacccgccacagtag

DBGET integrated database retrieval system