KEGG   Escherichia coli K-12 MG1655: b3810
Entry
b3810             CDS       T00007                                 

Gene name
yigA
Definition
(RefSeq) conserved protein YigA
  KO
K09921  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    b3810 (yigA)
SSDB
Motif
Pfam: DUF484 ScsC_N
Other DBs
NCBI-GeneID: 948359
NCBI-ProteinID: NP_418255
Pasteur: yigA
RegulonDB: ECK120001181
ECOCYC: EG11201
ASAP: ABE-0012444
UniProt: P23305
Position
3995583..3996290
AA seq 235 aa
MKQPGEELQETLTELDDRAVVDYLIKNPEFFIRNARAVEAIRVPHPVRGTVSLVEWHMAR
ARNHIHVLEENMALLMEQAIANEGLFYRLLYLQRSLTAASSLDDMLMRFHRWARDLGLAG
ASLRLFPDRWRLGAPSNHTHLALSRQSFEPLRIQRLGQEQHYLGPLNGPELLVVLPEAKA
VGSVAMSMLGSDADLGVVLFTSRDASHYQQGQGTQLLHEIALMLPELLERWIERV
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaagcaaccaggggaagaactgcaggaaacactcacggagcttgatgaccgggcggtt
gtcgattatctgattaaaaatcctgagttttttatccgtaatgcgcgcgcagtagaagcg
atacgtgtgccgcatccggtacgcggcaccgtttcgttggtcgagtggcacatggcccgc
gcacgtaatcatattcatgttctggaagagaacatggcgctgttgatggaacaggctatc
gccaacgaaggcctgttttatcgcctactctacctgcagcgcagtctcaccgccgccagc
agtctcgacgatatgctgatgcgctttcaccgctgggcgcgcgatctcggcctggcaggt
gcgagtctgcgcctgtttccggatcgctggcgcttaggtgcgccgtcgaaccacactcat
ctggcattaagccgtcagtctttcgaaccgctgcgtattcagcgtttggggcaggaacag
cactatcttgggccgcttaacggaccagagctgctggtggtgctaccggaagcgaaagcg
gtgggatcggtggcgatgtcgatgctgggaagcgatgctgatttgggtgtcgtgctgttt
accagtcgcgatgccagtcactatcaacaagggcaaggaacgcagttacttcatgaaatt
gcgctgatgttgccggagcttctggagcgttggattgaacgcgtatga

DBGET integrated database retrieval system