KEGG   Escherichia coli K-12 MG1655: b3819
Entry
b3819             CDS       T00007                                 
Symbol
rarD
Name
(RefSeq) putative transporter RarD
  KO
K05786  chloramphenicol-sensitive protein RarD
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3819 (rarD)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b3819 (rarD)
SSDB
Motif
Pfam: EamA FixS DUF2070
Other DBs
NCBI-GeneID: 948330
NCBI-ProteinID: YP_026262
RegulonDB: ECK120001428
ECOCYC: EG11466
ASAP: ABE-0012472
UniProt: P27844
Position
complement(4003288..4004178)
AA seq 296 aa
MDAKQTRQGVLLALAAYFIWGIAPAYFKLIYYVPADEILTHRVIWSFFFMVVLMSICRQW
SYLKTLIQTPQKIFMLAVSAVLIGGNWLLFIWAVNNHHMLEASLGYFINPLVNIVLGMIF
LGERFRRMQWLAVILAICGVLVQLWTFGSLPIIALGLAFSFAFYGLVRKKIAVEAQTGML
IETMWLLPVAAIYLFAIADSSTSHMGQNPMSLNLLLIAAGIVTTVPLLCFTAAATRLRLS
TLGFFQYIGPTLMFLLAVTFYGEKPGADKMVTFAFIWVALAIFVMDAIYTQRRTSK
NT seq 891 nt   +upstreamnt  +downstreamnt
atggatgcaaaacaaacgcggcagggcgtattactcgctcttgccgcttattttatttgg
ggtatagcgccagcgtacttcaagttgatttactacgtgcccgccgatgaaatcctgacg
catcgcgtgatctggtcgtttttctttatggtggtgctgatgagcatttgccgccagtgg
tcctatttaaaaacgctgattcagacgccacagaaaatttttatgctggcagtctctgcc
gtgctgattggtggcaactggctactgtttatctgggcggtgaacaatcaccatatgctg
gaagcgagccttggttactttattaacccgctggtgaacattgtgctggggatgattttc
ctcggcgagcgattccgccggatgcaatggctggcggtgattctggcgatatgtggcgtg
ttagtccagctgtggacttttggttcgctacctattatcgcgctgggactggcatttagt
tttgccttctacggtctggtacgcaagaagattgccgttgaagcgcaaaccggcatgtta
atcgaaaccatgtggctgctgcccgtggcggcaatttacctgtttgctattgccgacagc
tcaaccagccatatggggcaaaacccgatgtcgctgaatttactgctgatcgccgccggt
attgtcactaccgtaccgctgttgtgttttaccgccgctgccacgcgcttgcgtctctca
acgttaggctttttccagtacattggcccgacgctgatgttcctgctggctgtgacgttt
tatggtgaaaaaccgggtgccgataagatggtgactttcgcctttatttgggtggcgctg
gcaatttttgtgatggatgcgatttatacgcagcgtagaacgtccaaataa

DBGET integrated database retrieval system