KEGG   Escherichia coli K-12 MG1655: b3824
Entry
b3824             CDS       T00007                                 

Gene name
rhtB
Definition
(RefSeq) L-homoserine/L-homoserine lactone/L-threonine exporter
  KO
K05834  homoserine/homoserine lactone efflux protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b3824 (rhtB)
Transporters [BR:eco02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   b3824 (rhtB)
Motif
Pfam: LysE
Other DBs
NCBI-GeneID: 948316
NCBI-ProteinID: YP_026265
RegulonDB: ECK120001431
ECOCYC: EG11469
ASAP: ABE-0012490
UniProt: P0AG34
Position
complement(4008439..4009059)
AA seq 206 aa
MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVG
LGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNL
TNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMIGYATLAQRIALWIKGPK
QMKALNKIFGSLFMLVGALLASARHA
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaccttagaatggtggtttgcctacctgctgacatcgatcattttaagcctgtcgcca
ggctctggtgcaatcaacactatgaccacctcgctcaaccacggttatcgcggcgcggtg
gcgtctattgctgggcttcagaccggactggcgattcatattgtgctggttggcgtgggg
ttggggacgctattttcccgctcagtgattgcgtttgaagtgttgaagtgggcaggcgcg
gcttacttgatttggctgggaatccagcagtggcgcgccgctggtgcaattgaccttaaa
tcgctggcctctactcaatcgcgtcgacatttgttccagcgcgcagtttttgtgaatctc
accaatcccaaaagtattgtgtttctggcggcgctatttccgcaattcatcatgccgcaa
cagccgcaactgatgcagtatatcgtgctcggcgtcaccactattgtggtcgatattatt
gtgatgatcggttacgccacccttgctcaacggattgctctatggattaaaggaccaaag
cagatgaaggcgctgaataagattttcggctcgttgtttatgctggtgggagcgctgtta
gcatcggcgaggcatgcgtga

DBGET integrated database retrieval system