KEGG   Escherichia coli K-12 MG1655: b3834
Entry
b3834             CDS       T00007                                 

Gene name
ubiJ
Definition
(RefSeq) ubiquinone biosynthesis accessory factor UbiJ
  KO
K03690  ubiquinone biosynthesis protein UbiJ
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    b3834 (ubiJ)
SSDB
Motif
Pfam: SCP2 Alkyl_sulf_C
Other DBs
NCBI-GeneID: 948915
NCBI-ProteinID: NP_418278
Pasteur: yigP
RegulonDB: ECK120001436
ECOCYC: EG11474
ASAP: ABE-0012536
UniProt: P0ADP7
Structure
PDB: 
6H6O 6H6N 6H6P

Position
4019624..4020229
AA seq 201 aa
MPFKPLVTAGIESLLNTFLYRSPALKTARSRLLGKVLRVEVKGFSTSLILVFSERQVDVL
GEWAGDADCTVIAYASVLPKLRDRQQLTALIRSGELEVQGDIQVVQNFVALADLAEFDPA
ELLAPYTGDIAAEGISKAMRGGAKFLHHGIKRQQRYVAEAITEEWRMAPGPLEVAWFAEE
TAAVERAVDALTKRLEKLEAK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgccttttaaacctttagtgacggcaggaattgaaagtctgctcaacaccttcctgtat
cgctcacccgcgctgaaaacggcccgctcgcgtctgctgggtaaagtattgcgcgtggag
gtaaaaggcttttcgacgtcattgattctggtgttcagcgaacgccaggttgatgtactg
ggcgaatgggcaggcgatgctgactgcaccgttatcgcctacgccagtgtgttgccgaaa
cttcgcgatcgccagcagcttaccgcactgattcgcagtggtgagctggaagtgcagggc
gatattcaggtggtgcaaaacttcgttgcgctggcagatctggcagagttcgaccctgcg
gaactgctggccccttataccggtgatatcgccgctgaaggaatcagcaaagccatgcgc
ggaggcgcaaagttcctgcatcacggcattaagcgccagcaacgttatgtggcggaagcc
attactgaagagtggcgtatggcacccggtccgcttgaagtggcctggtttgcggaagag
acggctgccgtcgagcgtgctgttgatgccctgaccaaacggctggaaaaactggaggct
aaatga

DBGET integrated database retrieval system