KEGG   Escherichia coli K-12 MG1655: b3836Help
Entry
b3836             CDS       T00007                                 

Gene name
tatA
Definition
(RefSeq) twin arginine protein translocation system - TatA protein
  KO
K03116  sec-independent protein translocase protein TatA
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco03060  Protein export
eco03070  Bacterial secretion system
Module
eco_M00336  Twin-arginine translocation (Tat) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    b3836 (tatA)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    b3836 (tatA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eco02044]
    b3836 (tatA)
Secretion system [BR:eco02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein [MD:M00336]
   b3836 (tatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MttA_Hcf106 DUF1980 DUF4834
Motif
Other DBs
NCBI-GeneID: 948321
NCBI-ProteinID: NP_418280
Pasteur: tatA
RegulonDB: ECK120004314
ECOCYC: G7806
ASAP: ABE-0012541
UniProt: P69428 A0A387D163
Structure
PDB: 

Position
4021945..4022214
Genome map
AA seq 89 aa AA seqDB search
MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFT
AKTIADKQADTNQEQAKTEDAKRHDKEQV
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtatcagtatttggcagttattgattattgccgtcatcgttgtactgcttttt
ggcaccaaaaagctcggctccatcggttccgatcttggtgcgtcgatcaaaggctttaaa
aaagcaatgagcgatgatgaaccaaagcaggataaaaccagtcaggatgctgattttact
gcgaaaactatcgccgataagcaggcggatacgaatcaggaacaggctaaaacagaagac
gcgaagcgccacgataaagagcaggtgtaa

DBGET integrated database retrieval system