KEGG   Escherichia coli K-12 MG1655: b3850Help
Entry
b3850             CDS       T00007                                 

Gene name
hemG
Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00230  menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00860  Porphyrin and chlorophyll metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
Module
eco_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    b3850 (hemG)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.3  protoporphyrinogen IX dehydrogenase (menaquinone)
     b3850 (hemG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_5 Flavodoxin_1 Flavodoxin_3 SBP_bac_5 DUF2194 PTS_IIB FMN_red
Motif
Other DBs
NCBI-GeneID: 948331
NCBI-ProteinID: NP_418292
Pasteur: hemG
RegulonDB: ECK120001441
ECOCYC: EG11485
ASAP: ABE-0012577
UniProt: P0ACB4
Position
4034608..4035153
Genome map
AA seq 181 aa AA seqDB search
MKTLILFSTRDGQTREIASYLASELKELGIQADVANVHRIEEPQWENYDRVVIGASIRYG
HYHSAFQEFVKKHATRLNSMPSAFYSVNLVARKPEKRTPQTNSYARKFLMNSQWRPDRCA
VIAGALRYPRYRWYDRFMIKLIMKMSGGETDTRKEVVYTDWEQVANFAREIAHLTDKPTL
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacattaattcttttctcaacaagggacggacaaacgcgcgagattgcctcctac
ctggcttcggaactgaaagaactggggatccaggcggatgtcgccaatgtgcaccgcatt
gaagaaccacagtgggaaaactatgaccgtgtggtcattggtgcttctattcgctatggt
cactaccattcagcgttccaggaatttgtcaaaaaacatgcgacgcggctgaattcgatg
ccgagcgccttttactccgtgaatctggtggcgcgcaaaccggagaagcgtactccacag
accaacagctacgcgcgcaagtttctgatgaactcgcaatggcgtcccgatcgctgcgcg
gtcattgccggggcgctgcgttacccacgttatcgctggtacgaccgttttatgatcaag
ctgattatgaagatgtcaggcggtgaaacggatacgcgcaaagaagttgtctataccgat
tgggagcaggtggcgaatttcgcccgagaaatcgcccatttaaccgacaaaccgacgctg
aaataa

DBGET integrated database retrieval system