KEGG   Escherichia coli K-12 MG1655: b3870Help
Entry
b3870             CDS       T00007                                 

Gene name
glnA
Definition
(RefSeq) glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00220  Arginine biosynthesis
eco00250  Alanine, aspartate and glutamate metabolism
eco00630  Glyoxylate and dicarboxylate metabolism
eco00910  Nitrogen metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco01230  Biosynthesis of amino acids
eco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3870 (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    b3870 (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    b3870 (glnA)
   00220 Arginine biosynthesis
    b3870 (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    b3870 (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eco04147]
    b3870 (glnA)
Enzymes [BR:eco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     b3870 (glnA)
Exosome [BR:eco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   b3870 (glnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-GeneID: 948370
NCBI-ProteinID: NP_418306
Pasteur: glnA
RegulonDB: ECK120000376
ECOCYC: EG10383
ASAP: ABE-0012640
UniProt: P0A9C5
Position
complement(4056625..4058034)
Genome map
AA seq 469 aa AA seqDB search
MSAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKG
INESDMVLMPDASTAVIDPFFADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRSTG
IADTVLFGPEPEFFLFDDIRFGSSISGSHVAIDDIEGAWNSSTQYEGGNKGHRPAVKGGY
FPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYK
YVVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLSKNGVNLFAGDKYAGLSEQALYYIG
GVIKHAKAINALANPTTNSYKRLVPGYEAPVMLAYSARNRSASIRIPVVSSPKARRIEVR
FPDPAANPYLCFAALLMAGLDGIKNKIHPGEAMDKNLYDLPPEEAKEIPQVAGSLEEALN
ELDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctgaacacgtactgacgatgctgaacgagcacgaagtgaagtttgttgatttg
cgcttcaccgatactaaaggtaaagaacagcacgtcactatccctgctcatcaggtgaat
gctgaattcttcgaagaaggcaaaatgtttgacggctcctcgattggcggctggaaaggc
attaacgagtccgacatggtgctgatgccagacgcatccaccgcagtgattgacccgttc
ttcgccgactccaccctgattatccgttgcgacatccttgaacctggcaccctgcaaggc
tatgaccgtgacccgcgctccattgcgaagcgcgccgaagattacctgcgttccactggc
attgccgacaccgtactgttcgggccagaacctgaattcttcctgttcgatgacatccgt
ttcggatcatctatctccggttcccacgttgctatcgacgatatcgaaggcgcatggaac
tcctccacccaatacgaaggtggtaacaaaggtcaccgtccggcagtgaaaggcggttac
ttcccggttccaccggtagactcggctcaggatattcgttctgaaatgtgtctggtgatg
gaacagatgggtctggtggttgaagcccatcaccacgaagtagcgactgctggtcagaac
gaagtggctacccgcttcaataccatgaccaaaaaagctgacgaaattcagatctacaaa
tatgttgtgcacaacgtagcgcaccgcttcggtaaaaccgcgacctttatgccaaaaccg
atgttcggtgataacggctccggtatgcactgccacatgtctctgtctaaaaacggcgtt
aacctgttcgcaggcgacaaatacgcaggtctgtctgagcaggcgctgtactacattggc
ggcgtaatcaaacacgctaaagcgattaacgccctggcaaacccgaccaccaactcttat
aagcgtctggtcccgggctatgaagcaccggtaatgctggcttactctgcgcgtaaccgt
tctgcgtctatccgtattccggtggtttcttctccgaaagcacgtcgtatcgaagtacgt
ttcccggatccggcagctaacccgtacctgtgctttgctgccctgctgatggccggtctt
gatggtatcaagaacaagatccatccgggcgaagccatggacaaaaacctgtatgacctg
ccgccagaagaagcgaaagagatcccacaggttgcaggctctctggaagaagcactgaac
gaactggatctggaccgcgagttcctgaaagccggtggcgtgttcactgacgaagcaatt
gatgcgtacatcgctctgcgtcgcgaagaagatgaccgcgtgcgtatgactccgcatccg
gtagagtttgagctgtactacagcgtctaa

DBGET integrated database retrieval system