KEGG   Escherichia coli K-12 MG1655: b3874Help
Entry
b3874             CDS       T00007                                 

Gene name
yihN
Definition
(RefSeq) putative transporter YihN
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 948365
NCBI-ProteinID: NP_418310
Pasteur: yihN
RegulonDB: ECK120001771
ECOCYC: EG11840
ASAP: ABE-0012656
UniProt: P32135 A0A387D784
Position
4062247..4063512
Genome map
AA seq 421 aa AA seqDB search
MLTKKKWALFSLLTLCGGTIYKLPSLKDAFYIPMQEYFHLTNGQIGNAMSVNSFVTTVGF
FLSIYFADKLPRRYTMSFSLIATGLLGVYLTTMPGYWGILFVWALFGVTCDMMNWPVLLK
SVSRLGNSEQQGRLFGFFETGRGIVDTVVAFSALAVFTWFGSGLLGFKAGIWFYSLIVIA
VGIIIFFVLNDKEEAPSVEVKKEDGASKNTSMTSVLKDKTIWLIAFNVFFVYAVYCGLTF
FIPFLKNIYLLPVALVGAYGIINQYCLKMIGGPIGGMISDKILKSPSKYLCYTFIISTAA
LVLLIMLPHESMPVYLGMACTLGFGAIVFTQRAVFFAPIGEAKIAENKTGAAMALGSFIG
YAPAMFCFSLYGYILDLNPGIIGYKIVFGIMACFAFSGAVVSVMLVKRISQRKKEMLAAE
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgaaaaagaaatgggcgttatttagtctattaacactgtgtggcggtacaatt
tataaattaccgtcgctgaaagatgcgttttatatcccgatgcaggaatatttccatttg
accaatggtcaaattggtaatgctatgtcggtaaactcatttgtcaccacagtgggcttt
tttctgtctatttattttgccgataaactaccgcgcagatacaccatgtcattctcactc
attgcgacaggattactgggtgtttatttgacgacaatgccggggtattggggcatcctc
tttgtctgggcgctatttggcgttacttgcgacatgatgaactggccggtcttgctcaag
tcggtaagtcgattgggcaatagcgaacaacaaggtcggttgtttggcttcttcgaaaca
gggcgtggcattgtcgataccgtggtggcattttctgcgttggcagtatttacctggttt
ggcagtggcttattaggttttaaagcaggcatctggttctattcccttattgtgattgcc
gtaggcattattattttctttgtcctgaatgacaaagaagaggcaccgtccgttgaggtg
aaaaaagaagacggagcatcgaaaaacaccagtatgacctcggtgctgaaagacaaaact
atctggcttatcgcttttaacgtcttcttcgtttacgcggtttactgtggcctgacattc
ttcattccattcctgaaaaacatctatctattgcccgttgcgctggtgggggcttacggc
atcattaaccaatactgtctgaaaatgattggtggaccgattggtggcatgatttcagat
aagatcctgaaatcgccaagtaaatatctatgctacacctttatcattagtaccgctgcg
ctcgtactgttgattatgctgccgcacgaaagtatgccggtctatttagggatggcatgt
acgctgggctttggcgcgatagtctttacacagcgagccgtattttttgcacctatcggc
gaagcaaaaattgctgaaaataaaacaggtgcggcgatggcgttgggtagctttattggt
tacgctccggcgatgttctgcttcagtctgtatggctacattctggatttaaatccgggg
attattggctacaaaatcgtgtttggcattatggcctgcttcgcattcagtggtgcggtg
gtttccgtaatgctggttaagcgtattagccaacgtaagaaagagatgctggcggctgaa
gcttaa

DBGET integrated database retrieval system