KEGG   Escherichia coli K-12 MG1655: b3875Help
Entry
b3875             CDS       T00007                                 

Gene name
ompL
Definition
(RefSeq) outer membrane porin L; putative sulpholipid porin
  KO
K22110  oligogalacturonate-specific porin family protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Pores ion channels [TC:1]
   b3875 (ompL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KdgM BBP2 OMP_b-brl
Motif
Other DBs
NCBI-GeneID: 948366
NCBI-ProteinID: NP_418311
Pasteur: yshA
RegulonDB: ECK120004316
ECOCYC: G7814
ASAP: ABE-0012659
UniProt: P76773
Position
complement(4063603..4064295)
Genome map
AA seq 230 aa AA seqDB search
MKKINAIILLSSLTSASVFAGAYVENREAYNLASDQGEVMLRVGYNFDMGAGIMLTNTYN
FQREDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFVPWFNL
TVRNRYNHNNYSSTDLSGELDNNDTYEIGTYWNFKITDKFSYTFEPHYFMRVNDFNSSNG
KDHHWEITNTFRYRINEHWLPYFELRWLDRNVEPYHREQNQIRIGTKYFF
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattaatgcaataattttattatcttctctgacctctgcctcggtatttgct
ggcgcatacgtcgaaaacagggaggcatataatcttgcctccgatcagggcgaggttatg
ctacgtgtgggttataacttcgatatgggcgcgggtattatgttaaccaatacctacaac
tttcagcgagaagatgaactaaaacatggatataacgaaattgaaggctggtatccgtta
tttaaaccaaccgataaattaaccatccagcccggtggcttaattaatgataagagtatc
ggttcgggtggtgcagtgtatctggacgtcaactataaatttgtaccatggtttaatctg
acagtacgaaatcgctataaccataataactatagttcaacagatttgagcggggaactg
gataataatgacacctatgaaattggcacctactggaattttaaaatcaccgataaattt
tcctatacatttgagccacattacttcatgcgagtgaatgactttaatagtagcaacggg
aaagatcatcattgggaaatcactaacaccttccgttaccgtattaatgaacactggctc
ccttatttcgaattgcgctggttagaccgcaacgtcgaaccgtaccaccgcgagcaaaac
cagatccgtatcgggacgaagtatttcttctga

DBGET integrated database retrieval system