KEGG   Escherichia coli K-12 MG1655: b3892Help
Entry
b3892             CDS       T00007                                 

Gene name
fdoI
Definition
(RefSeq) formate dehydrogenase O subunit gamma
  KO
K00127  formate dehydrogenase subunit gamma
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00630  Glyoxylate and dicarboxylate metabolism
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3892 (fdoI)
  09102 Energy metabolism
   00680 Methane metabolism
    b3892 (fdoI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405 PapJ PepSY_TM
Motif
Other DBs
NCBI-GeneID: 948383
NCBI-ProteinID: NP_418328
Pasteur: fdoI
RegulonDB: ECK120001787
ECOCYC: EG11856
ASAP: ABE-0012705
UniProt: P0AEL0
Position
complement(4081225..4081860)
Genome map
AA seq 211 aa AA seqDB search
MKRRDTIVRYTAPERINHWITAFCFILAAVSGLGFLFPSFNWLMQIMGTPQLARILHPFV
GVVMFASFIIMFFRYWHHNLINRDDIFWAKNIRKIVVNEEVGDTGRYNFGQKCVFWAAII
FLVLLLVSGVIIWRPYFAPAFSIPVIRFALMLHSFAAVALIVVIMVHIYAALWVKGTITA
MVEGWVTSAWAKKHHPRWYREVRKTTEKKAE
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtgacaccatcgtgcgctacaccgcgccggaacgtatcaaccactggatc
accgccttctgcttcatcctggcggcggtgagcgggctgggctttttgttcccgtccttc
aactggttgatgcaaatcatgggcacaccgcagctggcgcgaattctgcacccgtttgtc
ggcgtggttatgtttgcctcgttcatcatcatgtttttccgttactggcatcacaaccta
atcaatcgggatgatatcttttgggcgaagaatattcgtaagatcgtcgtcaacgaggaa
gtaggtgacaccgggcgttataacttcggtcagaaatgcgttttctgggcggcgattatt
ttcctggttctgctgctggtgagcggcgtgattatctggcgtccttattttgcgcctgct
ttctcaatcccggtgatccgattcgcgttaatgctgcattcatttgccgcagtggcgtta
attgtggttatcatggtgcatatctacgccgccctttgggtgaaaggcacgattaccgcc
atggtggaaggatgggttaccagcgcctgggcgaagaaacatcacccgcgctggtaccgt
gaggtccgcaagacaacggaaaagaaagctgaatga

DBGET integrated database retrieval system