KEGG   Escherichia coli K-12 MG1655: b3893Help
Entry
b3893             CDS       T00007                                 

Gene name
fdoH
Definition
(RefSeq) formate dehydrogenase O subunit beta
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00630  Glyoxylate and dicarboxylate metabolism
eco00680  Methane metabolism
eco01100  Metabolic pathways
eco01120  Microbial metabolism in diverse environments
eco01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3893 (fdoH)
  09102 Energy metabolism
   00680 Methane metabolism
    b3893 (fdoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_9 Fer4_10 Fer4_6 Fer4_21 Fer4_2 Fer4 Fer4_16 Fer4_17 Fer4_3 Fer4_4 Fer4_8 Fer4_22 Fer4_20 Fer4_18
Motif
Other DBs
NCBI-GeneID: 948395
NCBI-ProteinID: NP_418329
Pasteur: fdoH
RegulonDB: ECK120001788
ECOCYC: EG11857
ASAP: ABE-0012708
UniProt: P0AAJ5
Position
complement(4081857..4082759)
Genome map
AA seq 300 aa AA seqDB search
MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKACQVACSEWNDIRDTVG
NNIGVYDNPNDLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQ
YANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCP
TGAIHFGTKESMKTLASERVAELKTRGYDNAGLYDPAGVGGTHVMYVLHHADKPNLYHGL
PENPEISETVKFWKGIWKPLAAVGFAATFAASIFHYVGVGPNRADEEENNLHEEKDEERK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaatctcaagatatcattcgtcgttccgcgactaacggtctgacccccgcg
cctcaggcgcgggacttccaggaagaagtggcgaaactcatcgacgttaccacctgtatc
ggctgtaaagcctgtcaggtggcgtgttcagagtggaacgacattcgcgataccgtcggc
aataacattggggtgtacgacaaccccaatgatttaagcgccaaatcgtggacggtaatg
cgcttctcggaagtggagcagaacgacaaactggaatggctgatccgcaaagacggctgt
atgcactgttccgatccaggctgcctgaaagcgtgcccggcggaaggtgcaattattcag
tatgccaacggtatcgtcgacttccagtccgagcagtgcattggctgcggttattgcatt
gcgggctgtccgttcgacattccgcgcctcaacccggaagacaaccgcgtctacaaatgt
acgctgtgcgttgaccgcgtggtggttgggcaagaaccagcctgcgtgaagacctgccca
acgggcgcgattcacttcggtacgaaagagtcgatgaaaacgctggcgagcgagcgcgtt
gctgagctgaaaacccgcggttacgacaatgcgggtctgtacgatccggcaggcgtcggt
ggtacacacgtcatgtacgtgctgcaccatgctgacaagccaaatctgtatcatggcttg
ccggagaacccggaaatcagcgaaaccgtgaaattctggaaaggcatctggaaaccgctc
gcggctgttggctttgcggctacctttgcggccagtatcttccactacgtgggtgtcggt
ccgaaccgtgcggatgaggaagagaataatctgcacgaagagaaagacgaggagcgcaaa
tga

DBGET integrated database retrieval system