KEGG   Escherichia coli K-12 MG1655: b3897Help
Entry
b3897             CDS       T00007                                 

Gene name
frvR
Definition
(RefSeq) putative transcriptional regulator FrvR
  KO
K18531  putative frv operon regulatory protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b3897 (frvR)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Other transcription factors
   BglG family
    b3897 (frvR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 HTH_11 HTH_AsnC-type HTH_24 HTH_5 HTH_DeoR HTH_Mga
Motif
Other DBs
NCBI-GeneID: 948389
NCBI-ProteinID: NP_418333
Pasteur: frvR
RegulonDB: ECK120001792
ECOCYC: EG11861
ASAP: ABE-0012720
UniProt: P32152 A0A387CYZ7
Position
complement(4088107..4089855)
Genome map
AA seq 582 aa AA seqDB search
MLNERQLKIVDLLEQQPRTPGELAQQTGVSGRTILRDIDYLNFTLNGKARIFASGSAGYQ
LEIFERRSFFQLLQKHDNDDRLLALLLLNTFTPRAQLASALNLPETWVAERLPRLKQRYE
RTCCLASRPGLGHFIDETEEKRVILLANLLRKDPFLIPLAGITRDNLQHLSTACDNQHRW
PLMQGDYLSSLILAIYALRNQLTDEWPQYPGDEIKQIVEHSGLFLGDNAVRTLTGLIEKQ
HQQAQVISADNVQGLLQRVPGIASLNIIDAQLVENITGHLLRCLAAPVWIAEHRQSSMNN
LKAAWPAAFDMSLHFITLLREQLDIPLFDSDLIGLYFACALERHQNERQPIILLSDQNAI
ATINQLAIERDVLNCRVIIARSLSELVAIREEIEPLLIINNSHYLLDDAVNNYITVKNII
TAAGIEQIKHFLATAFIRQQPERFFSAPGSFHYSNVRGESWQHITRQICAQLVAQHHITA
DEAQRIIAREGEGENLIVNRLAIPHCWSEQERRFRGFFITLAQPVEVNNEVINHVLIACA
AADARHELKIFSYLASILCQHPAEIIAGLTGYEAFMELLHKG
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgaacgccagttaaagattgtcgatctgctggagcaacagccgcgcacgcct
ggcgagctggcgcaacagactggcgtttcaggcaggaccatcctgcgtgatattgactat
ctcaacttcacccttaacggcaaagcccgcattttcgccagtggcagtgcgggctatcag
ctggaaatcttcgagcgccgcagcttttttcagttgctgcaaaagcacgataacgacgat
cggctgctggcgctgttattactgaatactttcactccccgtgcgcaactcgcctcggcg
cttaatttgccagaaacgtgggtagcagagcgtctgccccggttaaaacagcgttatgaa
cgcacttgttgcctggccagccgccctggtttgggccatttcattgatgagacagaagag
aaacgcgttatcttgctggcgaacttgctgcgcaaagatccgtttttaattccgctggcg
ggcataacacgagacaaccttcagcatttatccacggcctgcgacaaccaacaccgctgg
ccgctcatgcagggtgattatctctccagcctgattctggcgatttacgccctgcgtaat
caactgaccgatgagtggccgcaatatcccggtgacgagataaaacaaatcgttgaacat
agcggtctgtttcttggtgataacgctgtaagaaccctgacgggtttgatagagaaacag
catcagcaagcgcaggtaatttcagccgataatgtgcaggggttgctgcaaagggtgccg
ggcatcgcgtcattgaatattattgatgcgcagctggttgagaatattaccgggcattta
ttacgttgccttgccgcaccagtgtggattgctgagcaccgccagagcagcatgaataac
ctgaaagccgcctggcctgcggcctttgatatgagtctgcactttattacgctactgcgt
gaacagctcgatattccccttttcgacagcgatctgatcggtttgtattttgcctgtgcg
ctggagcggcatcaaaacgaacgccagccgatcattttgctctcggaccagaacgcgatt
gccactattaatcagctcgccattgagcgcgatgttttaaattgtcgggtaattattgcc
cgtagcttaagcgaacttgttgccattcgcgaagagattgagccgttattgatcattaac
aacagccattatttactggatgacgcggtaaataattacatcaccgtaaaaaatatcatt
acggctgccggtatcgaacaaataaaacattttctggcgacggcatttattcgccaacag
ccggagcgttttttctctgcccccggaagttttcattattcgaatgtacgcggtgaaagc
tggcaacatattacccggcaaatttgtgcgcaattagtcgcacaacaccatattaccgcc
gatgaagcacaacgcatcatcgcccgcgaaggcgaaggtgaaaacctgattgttaatcgc
ctcgccatcccacattgctggagcgaacaggagcgacgttttcgtggattttttattacc
ctcgcccaaccagttgaggtgaataacgaagtcattaaccatgtcttgatcgcctgcgcc
gccgccgatgcgcgtcatgagctaaaaatatttagctatctggcaagcatattgtgtcag
catccggcggagattattgccgggttaacaggatatgaggcatttatggagttacttcac
aaggggtga

DBGET integrated database retrieval system